
  1. TechSpot Forums are dedicated to computer enthusiasts and power users. Ask a question and give support. Join the community here.
    TechSpot Forums are dedicated to computer enthusiasts and power users.
    Ask a question and give support.
    Join the community here, it only takes a minute.
    Dismiss Notice

Computer running slow

By Jaabroni
Oct 2, 2011
  1. Hi, my computer had been running really slow since last month, I had tried scanning with malwarebytes, norton, superantispyware, ccleaner, iobit, and kept on showing adware cookies. No malware or viruses had come up yet from any of the searches, but I assume that this kind of malware is like a really powerful one as it does not come up on any of these scanners. I'm kind of stumped because I've spent like 2 weeks trying to fix this and I'm kind of a newb at this, so please help! If all else fails, I'm just going to have to sadly restore my computer to factory settings. Thanks in advance!
  2. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Welcome to TechSpot! Do you understand that there are many different causes of system slowdown>

    1, Too many programs starting on boot and running in the background.
    2. Inadequate maintenance.
    3. Multiple auto-updates
    4. You may have some malware, but it may not be the cause of the slowdown.
    If you would like us to check the system for malware, please follow the steps in the Preliminary Virus and Malware Removal thread HERE.

    NOTE: If you already have any of the scanning programs on the computer, please remove them and download the versions in these links.

    When you have finished, leave the logs for review in your next reply .
    NOTE: Logs must be pasted in the replies. Attached logs will not be reviewed.
    My Guidelines: please read and follow:
    • Be patient. Malware cleaning takes time and I am also working with other members while I am helping you.
    • Read my instructions carefully. If you don't understand or have a problem, ask me.
    • If you have questions, or if a program doesn't work, stop and tell me about it. Don't try to get around it yourself.
    • Follow the order of the tasks I give you. Order is crucial in cleaning process.
    • File sharing programs should be uninstalled or disabled during the cleaning process..
    • Observe these:
      [o] Don't use any other cleaning programs or scans while I'm helping you.
      [o] Don't use a Registry cleaner or make any changes in the Registry.
      [o] Don't download and install new programs- except those I give you.
    • Please let me know if there is any change in the system.

    If I don't get a reply from you in 5 days, the thread will be closed. If your problem persist, you can send a PM to reopen it.
  3. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Hi, thanks for replying! I'm sure this is a malware problem, as I regularly scan my computer weekly. The kind of slow I'm experiencing is that its good when I turn on the laptop, but then everything goes sluggish, like the sound from loading, and something is hogging up all my resources, with cpu at a constant 80%. I'm installing the GMER and dds and ill post the logs in a few, OH and not to mention, somehow I've clicked on the GMER links and none of them work... it just gave me a blank page and it sat there for 20 minutes.
    thanks in advance
  4. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Skip GMER for now and go on to the other steps.
  5. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18


    Malwarebytes' Anti-Malware

    Database version: 7848

    Windows 6.1.7601 Service Pack 1
    Internet Explorer 8.0.7601.17514

    10/2/2011 1:58:17 PM
    mbam-log-2011-10-02 (13-58-17).txt

    Scan type: Quick scan
    Objects scanned: 213424
    Time elapsed: 4 minute(s), 12 second(s)

    Memory Processes Infected: 0
    Memory Modules Infected: 0
    Registry Keys Infected: 0
    Registry Values Infected: 0
    Registry Data Items Infected: 0
    Folders Infected: 0
    Files Infected: 0

    Memory Processes Infected:
    (No malicious items detected)

    Memory Modules Infected:
    (No malicious items detected)

    Registry Keys Infected:
    (No malicious items detected)

    Registry Values Infected:
    (No malicious items detected)

    Registry Data Items Infected:
    (No malicious items detected)

    Folders Infected:
    (No malicious items detected)

    Files Infected:
    (No malicious items detected)


    : Norton Security Suite *Enabled/Updated* {63DF5164-9100-186D-2187-8DC619EFD8BF}
    SP: Windows Defender *Enabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
    SP: Norton Security Suite *Enabled/Updated* {D8BEB080-B73A-17E3-1B37-B6B462689202}
    FW: Norton Security Suite *Enabled* {5BE4D041-DB6F-1935-0AD8-24F3E73C9FC4}
    ============== Running Processes ===============
    C:\Windows\system32\svchost.exe -k DcomLaunch
    C:\Windows\system32\svchost.exe -k RPCSS
    C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
    C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
    C:\Windows\system32\svchost.exe -k netsvcs
    C:\Program Files\IDT\WDM\STacSV64.exe
    C:\Windows\system32\svchost.exe -k LocalService
    C:\Windows\system32\svchost.exe -k NetworkService
    C:\Program Files\DigitalPersona\Bin\DpHostW.exe
    C:\Windows\system32\svchost.exe -k LocalServiceNoNetwork
    C:\Program Files (x86)\IObit\IObit Malware Fighter\IMFsrv.exe
    C:\Program Files\SUPERAntiSpyware\SASCORE64.EXE
    C:\Program Files (x86)\IObit\Advanced SystemCare 4\ASCService.exe
    C:\Program Files\IDT\WDM\AESTSr64.exe
    C:\Windows\SysWOW64\svchost.exe -k Akamai
    C:\Program Files (x86)\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe
    C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe
    C:\Program Files (x86)\Bonjour\mDNSResponder.exe
    C:\Program Files (x86)\CinemaNow\CinemaNow Media Manager\CinemanowSvc.exe
    C:\Program Files\Intel\WiFi\bin\EvtEng.exe
    C:\Windows\system32\svchost.exe -k LocalServiceAndNoImpersonation
    C:\Program Files (x86)\Hewlett-Packard\Shared\HPDrvMntSvc.exe
    C:\Program Files\Hewlett-Packard\HP Quick Launch\HPWMISVC.exe
    C:\Program Files (x86)\Common Files\LightScribe\LSSrvc.exe
    C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\LMS\LMS.exe
    C:\Program Files (x86)\Norton Security Suite\Engine\\ccSvcHst.exe
    C:\Program Files\Common Files\Intel\WirelessCommon\RegSrvc.exe
    C:\Program Files (x86)\Microsoft\BingBar\SeaPort.EXE
    C:\Windows\system32\svchost.exe -k imgsvc
    C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVC.EXE
    C:\Users\TeTa\Comcast Constant Guard\IDVaultSvc.exe
    C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSvcM.exe
    C:\Windows\system32\svchost.exe -k NetworkServiceNetworkRestricted
    C:\Program Files (x86)\DigitalPersona\Bin\DPAgent.exe
    C:\Program Files (x86)\Norton Security Suite\Engine\\ccSvcHst.exe
    C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
    C:\Program Files\Hewlett-Packard\HP Quick Launch\HPMSGSVC.exe
    C:\Program Files\Hewlett-Packard\HPToneControl\HPToneCtl.exe
    C:\Program Files\Java\jre6\bin\jusched.exe
    C:\Program Files\Microsoft IntelliPoint\ipoint.exe
    C:\Program Files\IDT\WDM\sttray64.exe
    C:\Program Files\Hewlett-Packard\HP MediaSmart\SmartMenu.exe
    C:\Program Files\Common Files\Intel\WirelessCommon\iFrmewrk.exe
    C:\Program Files (x86)\Common Files\LightScribe\LightScribeControlPanel.exe
    C:\Program Files (x86)\BitTorrent\BitTorrent.exe
    C:\Program Files (x86)\DAEMON Tools Lite\DTLite.exe
    C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
    C:\Program Files\Windows Sidebar\sidebar.exe
    C:\Program Files (x86)\Skype\Phone\Skype.exe
    C:\Program Files (x86)\IObit\Advanced SystemCare 4\ASCTray.exe
    C:\Program Files (x86)\Stardock\ObjectDockFree\ObjectDock.exe
    C:\Program Files (x86)\Hp\HP Software Update\hpwuschd2.exe
    C:\Program Files (x86)\Real\RealPlayer\Update\realsched.exe
    C:\Program Files (x86)\iTunes\iTunesHelper.exe
    C:\Program Files (x86)\SFT\GuardedID\GIDD.exe
    C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe
    C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe
    C:\Program Files\DigitalPersona\Bin\DPAgent.exe
    C:\Program Files (x86)\Stardock\ObjectDockFree\Dock64.exe
    C:\Program Files\Hewlett-Packard\HP Wireless Assistant\HPWA_Service.exe
    C:\Program Files (x86)\SFT\GuardedID\x64\GIDD.exe
    C:\Program Files\iPod\bin\iPodService.exe
    C:\Windows\system32\svchost.exe -k HPService
    C:\Program Files\Windows Media Player\wmpnetwk.exe
    C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\MOM.exe
    C:\Program Files (x86)\Hewlett-Packard\Shared\hpqWmiEx.exe
    C:\Program Files (x86)\IObit\IObit Malware Fighter\IMF.exe
    C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\CCC.exe
    C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\UNS\UNS.exe
    C:\Program Files\Hewlett-Packard\HP Wireless Assistant\HPWA_Main.exe
    C:\Windows\System32\svchost.exe -k secsvcs
    C:\Program Files (x86)\Hewlett-Packard\Shared\hpCaslNotification.exe
    C:\Program Files (x86)\Hewlett-Packard\HP Advisor\HPAdvisor.exe
    C:\Program Files\Java\jre6\bin\jucheck.exe
    C:\Program Files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE
    C:\Program Files (x86)\Malwarebytes' Anti-Malware\mbam.exe
    ============== Pseudo HJT Report ===============
    uStart Page = hxxp://
    uInternet Settings,ProxyOverride = *.local
    uURLSearchHooks: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll
    mWinlogon: Userinit=userinit.exe,
    BHO: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll
    BHO: Adobe PDF Link Helper: {18df081c-e8ad-4283-a596-fa578c2ebdc3} - C:\Program Files (x86)\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelperShim.dll
    BHO: RealPlayer Download and Record Plugin for Internet Explorer: {3049c3e9-b461-4bc5-8870-4c09146192ca} - C:\ProgramData\Real\RealPlayer\BrowserRecordPlugin\IE\rpbrowserrecordplugin.dll
    BHO: Symantec NCO BHO: {602adb0e-4aff-4217-8aa1-95dac4dfa408} - C:\Program Files (x86)\Norton Security Suite\Engine\\coIEPlg.dll
    BHO: Symantec Intrusion Prevention: {6d53ec84-6aae-4787-aeee-f4628f01010c} - C:\Program Files (x86)\Norton Security Suite\Engine\\IPS\IPSBHO.DLL
    BHO: Windows Live ID Sign-in Helper: {9030d464-4c02-4abf-8ecc-5164760863c6} - C:\Program Files (x86)\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dll
    BHO: Office Document Cache Handler: {b4f3a835-0e21-4959-ba22-42b3008e02ff} - C:\PROGRA~2\MICROS~4\Office14\URLREDIR.DLL
    BHO: Constant Guard Protection Suite (COM): {b84cdbe7-1b46-494b-a188-01d4c52deb61} - C:\Users\TeTa\Comcast Constant Guard\NativeBHO.dll
    BHO: Bing Bar Helper: {d2ce3e00-f94a-4740-988e-03dc2f38c34f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
    BHO: Java(tm) Plug-In 2 SSV Helper: {dbc80044-a445-435b-bc74-9c25c1c588a9} - C:\Program Files (x86)\Java\jre6\bin\jp2ssv.dll
    TB: Norton Toolbar: {7febefe3-6b19-4349-98d2-ffb09d4b49ca} - C:\Program Files (x86)\Norton Security Suite\Engine\\coIEPlg.dll
    TB: Bing Bar: {8dcb7100-df86-4384-8842-8fa844297b3f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
    TB: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll
    TB: {D4027C7F-154A-4066-A1AD-4243D8127440} - No File
    uRun: [HPAdvisorDock] C:\Program Files (x86)\Hewlett-Packard\HP Advisor\Dock\HPAdvisorDock.exe
    uRun: [LightScribe Control Panel] C:\Program Files (x86)\Common Files\LightScribe\LightScribeControlPanel.exe -hidden
    uRun: [Google Update] "C:\Users\Alton\AppData\Local\Google\Update\GoogleUpdate.exe" /c
    uRun: [BitTorrent] "C:\Program Files (x86)\BitTorrent\BitTorrent.exe"
    uRun: [DAEMON Tools Lite] "C:\Program Files (x86)\DAEMON Tools Lite\DTLite.exe" -autorun
    uRun: [Steam] "C:\New Folder\steam.exe" -silent
    uRun: [Sidebar] C:\Program Files\Windows Sidebar\sidebar.exe /autoRun
    uRun: [Skype] "C:\Program Files (x86)\Skype\Phone\Skype.exe" /nosplash /minimized
    uRun: [SUPERAntiSpyware] C:\Program Files\SUPERAntiSpyware\SUPERAntiSpyware.exe
    uRun: [Advanced SystemCare 4] "C:\Program Files (x86)\IObit\Advanced SystemCare 4\ASCTray.exe"
    mRun: [Microsoft Default Manager] "C:\Program Files (x86)\Microsoft\Search Enhancement Pack\Default Manager\DefMgr.exe" -resume
    mRun: [NortonOnlineBackupReminder] "C:\Program Files (x86)\Symantec\Norton Online Backup\Activation\NOBuActivation.exe" UNATTENDED
    mRun: [HP Software Update] C:\Program Files (x86)\Hp\HP Software Update\HPWuSchd2.exe
    mRun: [StartCCC] "C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\CLIStart.exe" MSRun
    mRun: [TkBellExe] "C:\Program Files (x86)\Real\RealPlayer\update\realsched.exe" -osboot
    mRun: [QuickTime Task] "C:\Program Files (x86)\QuickTime\QTTask.exe" -atboottime
    mRun: [iTunesHelper] "C:\Program Files (x86)\iTunes\iTunesHelper.exe"
    mRun: [GIDDesktop] C:\Program Files (x86)\SFT\GuardedID\gidd.exe /s
    mRun: [SunJavaUpdateSched] "C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe"
    mRun: [IObit Malware Fighter] "C:\Program Files (x86)\IObit\IObit Malware Fighter\IMF.exe" /autostart
    StartupFolder: C:\Users\Alton\AppData\Roaming\MICROS~1\Windows\STARTM~1\Programs\Startup\Stardock ObjectDock.lnk - C:\Program Files (x86)\Stardock\ObjectDockFree\ObjectDock.exe
    StartupFolder: C:\PROGRA~3\MICROS~1\Windows\STARTM~1\Programs\Startup\Constant Guard.lnk - C:\Users\TeTa\Comcast Constant Guard\IDVault.exe
    StartupFolder: C:\PROGRA~3\MICROS~1\Windows\STARTM~1\Programs\Startup\GamersFirst LIVE!.lnk - C:\Program Files (x86)\GamersFirst\LIVE!\Live.exe
    mPolicies-explorer: NoActiveDesktop = 1 (0x1)
    mPolicies-explorer: NoActiveDesktopChanges = 1 (0x1)
    mPolicies-system: ConsentPromptBehaviorUser = 3 (0x3)
    mPolicies-system: EnableUIADesktopToggle = 0 (0x0)
    IE: E&xport to Microsoft Excel - C:\PROGRA~2\MICROS~4\Office14\EXCEL.EXE/3000
    IE: Se&nd to OneNote - C:\PROGRA~2\MICROS~4\Office14\ONBttnIE.dll/105
    IE: {219C3416-8CB2-491a-A3C7-D9FCDDC9D600} - {5F7B1267-94A9-47F5-98DB-E99415F33AEC} - C:\Program Files (x86)\Windows Live\Writer\WriterBrowserExtension.dll
    IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - C:\Program Files (x86)\Microsoft Office\Office14\ONBttnIE.dll
    IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - C:\Program Files (x86)\Microsoft Office\Office14\ONBttnIELinkedNotes.dll
    DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} - hxxp://
    DPF: {CAFEEFAC-0016-0000-0026-ABCDEFFEDCBA} - hxxp://
    TCP: DhcpNameServer =
    TCP: Interfaces\{3C4F5AAB-D4D8-4708-9349-C755C473C65A} : DhcpNameServer =
    TCP: Interfaces\{3C4F5AAB-D4D8-4708-9349-C755C473C65A}\140707C656025487472756D6560214962707F62747 : DhcpNameServer =
    TCP: Interfaces\{3C4F5AAB-D4D8-4708-9349-C755C473C65A}\3457E6E696E676D2A416D6563702E4564777F627B6 : DhcpNameServer =
    TCP: Interfaces\{3C4F5AAB-D4D8-4708-9349-C755C473C65A}\C696E6B6379737 : DhcpNameServer =
    TCP: Interfaces\{FB2F70A0-B767-4F9A-8A92-4C119C9C06BA} : NameServer =
    Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - C:\Program Files (x86)\Common Files\microsoft shared\OFFICE14\MSOXMLMF.DLL
    Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - C:\Program Files (x86)\Windows Live\Photo Gallery\AlbumDownloadProtocolHandler.dll
    LSA: Notification Packages = DPPassFilter scecli
    mASetup: {10880D85-AAD9-4558-ABDC-2AB1552D831F} - "C:\Program Files (x86)\Common Files\LightScribe\LSRunOnce.exe"
    mASetup: {9191979D-821C-4EA8-B021-2DA1D859A7C5}-3Reg - C:\Program Files (x86)\SFT\GuardedID\gidi.exe /v
    BHO-X64: IObit Toolbar: {0BDA0769-FD72-49F4-9266-E1FB004F4D8F} - C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll
    BHO-X64: Adobe PDF Link Helper: {18DF081C-E8AD-4283-A596-FA578C2EBDC3} - C:\Program Files (x86)\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelperShim.dll
    BHO-X64: AcroIEHelperStub - No File
    BHO-X64: RealPlayer Download and Record Plugin for Internet Explorer: {3049C3E9-B461-4BC5-8870-4C09146192CA} - C:\ProgramData\Real\RealPlayer\BrowserRecordPlugin\IE\rpbrowserrecordplugin.dll
    BHO-X64: Symantec NCO BHO: {602ADB0E-4AFF-4217-8AA1-95DAC4DFA408} - C:\Program Files (x86)\Norton Security Suite\Engine\\coIEPlg.dll
    BHO-X64: Symantec NCO BHO - No File
    BHO-X64: Symantec Intrusion Prevention: {6D53EC84-6AAE-4787-AEEE-F4628F01010C} - C:\Program Files (x86)\Norton Security Suite\Engine\\IPS\IPSBHO.DLL
    BHO-X64: Symantec Intrusion Prevention - No File
    BHO-X64: Windows Live ID Sign-in Helper: {9030D464-4C02-4ABF-8ECC-5164760863C6} - C:\Program Files (x86)\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dll
    BHO-X64: Office Document Cache Handler: {B4F3A835-0E21-4959-BA22-42B3008E02FF} - C:\PROGRA~2\MICROS~4\Office14\URLREDIR.DLL
    BHO-X64: URLRedirectionBHO - No File
    BHO-X64: Constant Guard Protection Suite (COM): {B84CDBE7-1B46-494B-A188-01D4C52DEB61} - C:\Users\TeTa\Comcast Constant Guard\NativeBHO.dll
    BHO-X64: Constant Guard Protection Suite (COM) - No File
    BHO-X64: Bing Bar Helper: {d2ce3e00-f94a-4740-988e-03dc2f38c34f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
    BHO-X64: Java(tm) Plug-In 2 SSV Helper: {DBC80044-A445-435b-BC74-9C25C1C588A9} - C:\Program Files (x86)\Java\jre6\bin\jp2ssv.dll
    TB-X64: Norton Toolbar: {7FEBEFE3-6B19-4349-98D2-FFB09D4B49CA} - C:\Program Files (x86)\Norton Security Suite\Engine\\coIEPlg.dll
    TB-X64: Bing Bar: {8dcb7100-df86-4384-8842-8fa844297b3f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
    TB-X64: IObit Toolbar: {0BDA0769-FD72-49F4-9266-E1FB004F4D8F} - C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll
    TB-X64: {D4027C7F-154A-4066-A1AD-4243D8127440} - No File
    mRun-x64: [Microsoft Default Manager] "C:\Program Files (x86)\Microsoft\Search Enhancement Pack\Default Manager\DefMgr.exe" -resume
    mRun-x64: [NortonOnlineBackupReminder] "C:\Program Files (x86)\Symantec\Norton Online Backup\Activation\NOBuActivation.exe" UNATTENDED
    mRun-x64: [HP Software Update] C:\Program Files (x86)\Hp\HP Software Update\HPWuSchd2.exe
    mRun-x64: [StartCCC] "C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\CLIStart.exe" MSRun
    mRun-x64: [TkBellExe] "C:\Program Files (x86)\Real\RealPlayer\update\realsched.exe" -osboot
    mRun-x64: [QuickTime Task] "C:\Program Files (x86)\QuickTime\QTTask.exe" -atboottime
    mRun-x64: [iTunesHelper] "C:\Program Files (x86)\iTunes\iTunesHelper.exe"
    mRun-x64: [GIDDesktop] C:\Program Files (x86)\SFT\GuardedID\gidd.exe /s
    mRun-x64: [SunJavaUpdateSched] "C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe"
    mRun-x64: [IObit Malware Fighter] "C:\Program Files (x86)\IObit\IObit Malware Fighter\IMF.exe" /autostart
    ============= SERVICES / DRIVERS ===============
    R0 SymDS;Symantec Data Store;C:\Windows\system32\drivers\N360x64\0501000.01D\SYMDS64.SYS --> C:\Windows\system32\drivers\N360x64\0501000.01D\SYMDS64.SYS [?]
    R0 SymEFA;Symantec Extended File Attributes;C:\Windows\system32\drivers\N360x64\0501000.01D\SYMEFA64.SYS --> C:\Windows\system32\drivers\N360x64\0501000.01D\SYMEFA64.SYS [?]
    R1 BHDrvx64;BHDrvx64;C:\ProgramData\Norton\{0C55C096-0F1D-4F28-AAA2-85EF591126E7}\N360_5.0.0.125\Definitions\BASHDefs\20110920.001\BHDrvx64.sys [2011-9-26 1152632]
    R1 DVMIO;DeviceVM IO Service;C:\Windows\system32\DRIVERS\dvmio.sys --> C:\Windows\system32\DRIVERS\dvmio.sys [?]
    R1 GIDv2;GIDv2;C:\Windows\system32\drivers\GIDv2.sys --> C:\Windows\system32\drivers\GIDv2.sys [?]
    R1 IDSVia64;IDSVia64;C:\ProgramData\Norton\{0C55C096-0F1D-4F28-AAA2-85EF591126E7}\N360_5.0.0.125\Definitions\IPSDefs\20110930.030\IDSviA64.sys [2011-10-1 488568]
    R1 SASDIFSV;SASDIFSV;C:\Program Files\SUPERAntiSpyware\sasdifsv64.sys [2011-7-22 14928]
    R1 SASKUTIL;SASKUTIL;C:\Program Files\SUPERAntiSpyware\saskutil64.sys [2011-7-12 12368]
    R1 SymIRON;Symantec Iron Driver;C:\Windows\system32\drivers\N360x64\0501000.01D\Ironx64.SYS --> C:\Windows\system32\drivers\N360x64\0501000.01D\Ironx64.SYS [?]
    R1 SymNetS;Symantec Network Security WFP Driver;C:\Windows\system32\Drivers\N360x64\0501000.01D\SYMNETS.SYS --> C:\Windows\system32\Drivers\N360x64\0501000.01D\SYMNETS.SYS [?]
    R1 vwififlt;Virtual WiFi Filter Driver;C:\Windows\system32\DRIVERS\vwififlt.sys --> C:\Windows\system32\DRIVERS\vwififlt.sys [?]
    R2 !SASCORE;SAS Core Service;C:\Program Files\SUPERAntiSpyware\SASCore64.exe [2011-8-11 140672]
    R2 {55662437-DA8C-40c0-AADA-2C816A897A49};Power Control [2010/06/08 02:55:25];C:\Program Files (x86)\Hewlett-Packard\Media\DVD\000.fcl [2010-6-8 146928]
    R2 AdvancedSystemCareService;Advanced SystemCare Service;C:\Program Files (x86)\IObit\Advanced SystemCare 4\ASCService.exe [2011-9-14 328536]
    R2 AESTFilters;Andrea ST Filters Service;C:\Program Files\IDT\WDM\AESTSr64.exe [2010-11-22 89600]
    R2 Akamai;Akamai NetSession Interface;C:\Windows\System32\svchost.exe -k Akamai [2009-7-13 20992]
    R2 AMD External Events Utility;AMD External Events Utility;C:\Windows\system32\atiesrxx.exe --> C:\Windows\system32\atiesrxx.exe [?]
    R2 Application Updater;Application Updater;C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe [2011-8-17 402328]
    R2 CinemaNow Service;CinemaNow Service;C:\Program Files (x86)\CinemaNow\CinemaNow Media Manager\CinemaNowSvc.exe [2010-1-15 127984]
    R2 DvmMDES;DeviceVM Meta Data Export Service;C:\SwSetup\QuickWeb\QW.SYS\config\DVMExportService.exe [2010-2-8 338168]
    R2 HP Wireless Assistant Service;HP Wireless Assistant Service;C:\Program Files\Hewlett-Packard\HP Wireless Assistant\HPWA_Service.exe [2009-12-16 102968]
    R2 HPDrvMntSvc.exe;HP Quick Synchronization Service;C:\Program Files (x86)\Hewlett-Packard\Shared\HPDrvMntSvc.exe [2011-7-5 227384]
    R2 hpsrv;HP Service;C:\Windows\system32\Hpservice.exe --> C:\Windows\system32\Hpservice.exe [?]
    R2 IDVaultSvc;CGPS Service;C:\Users\TeTa\Comcast Constant Guard\IDVaultSvc.exe [2011-8-31 62536]
    R2 IMFservice;IMF Service;C:\Program Files (x86)\IObit\IObit Malware Fighter\IMFsrv.exe [2011-9-14 820568]
    R2 N360;Norton Security Suite;C:\Program Files (x86)\Norton Security Suite\Engine\\ccsvchst.exe [2011-8-4 130008]
    R2 UNS;Intel(R) Management & Security Application User Notification Service;C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\UNS\UNS.EXE [2010-6-8 2320920]
    R2 vcsFPService;Validity VCS Fingerprint Service;C:\Windows\System32\vcsFPService.exe [2010-1-6 1791280]
    R3 amdkmdag;amdkmdag;C:\Windows\system32\DRIVERS\atikmdag.sys --> C:\Windows\system32\DRIVERS\atikmdag.sys [?]
    R3 amdkmdap;amdkmdap;C:\Windows\system32\DRIVERS\atikmpag.sys --> C:\Windows\system32\DRIVERS\atikmpag.sys [?]
    R3 AtiHDAudioService;ATI Function Driver for HD Audio Service;C:\Windows\system32\drivers\AtihdW76.sys --> C:\Windows\system32\drivers\AtihdW76.sys [?]
    R3 EraserUtilRebootDrv;EraserUtilRebootDrv;C:\Program Files (x86)\Common Files\Symantec Shared\EENGINE\EraserUtilRebootDrv.sys [2011-9-26 136824]
    R3 FileMonitor;FileMonitor;C:\Program Files (x86)\IObit\IObit Malware Fighter\Drivers\win7_amd64\FileMonitor.sys [2011-9-14 20336]
    R3 HECIx64;Intel(R) Management Engine Interface;C:\Windows\system32\DRIVERS\HECIx64.sys --> C:\Windows\system32\DRIVERS\HECIx64.sys [?]
    R3 Impcd;Impcd;C:\Windows\system32\DRIVERS\Impcd.sys --> C:\Windows\system32\DRIVERS\Impcd.sys [?]
    R3 intelkmd;intelkmd;C:\Windows\system32\DRIVERS\igdpmd64.sys --> C:\Windows\system32\DRIVERS\igdpmd64.sys [?]
    R3 NETwNs64;___ Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows 7 - 64 Bit;C:\Windows\system32\DRIVERS\NETwNs64.sys --> C:\Windows\system32\DRIVERS\NETwNs64.sys [?]
    R3 osppsvc;Office Software Protection Platform;C:\Program Files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE [2010-1-9 4925184]
    R3 RegFilter;RegFilter;C:\Program Files (x86)\IObit\IObit Malware Fighter\Drivers\win7_amd64\RegFilter.sys [2011-9-14 33184]
    R3 UrlFilter;UrlFilter;C:\Program Files (x86)\IObit\IObit Malware Fighter\Drivers\win7_amd64\UrlFilter.sys [2011-9-14 21328]
    R3 vwifimp;Microsoft Virtual WiFi Miniport Service;C:\Windows\system32\DRIVERS\vwifimp.sys --> C:\Windows\system32\DRIVERS\vwifimp.sys [?]
    R4 HPWMISVC;HPWMISVC;C:\Program Files\Hewlett-Packard\HP Quick Launch\HPWMISVC.exe [2010-1-18 20480]
    S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;C:\Windows\Microsoft.NET\Framework\v4.0.30319\mscorsvw.exe [2010-3-18 130384]
    S2 clr_optimization_v4.0.30319_64;Microsoft .NET Framework NGEN v4.0.30319_X64;C:\Windows\Microsoft.NET\Framework64\v4.0.30319\mscorsvw.exe [2010-3-18 138576]
    S2 HP Support Assistant Service;HP Support Assistant Service;C:\Program Files (x86)\Hewlett-Packard\HP Support Framework\HPSA_Service.exe [2011-6-21 85560]
    S3 BBSvc;Bing Bar Update Service;C:\Program Files (x86)\Microsoft\BingBar\BBSvc.EXE [2011-2-28 183560]
    S3 MyWiFiDHCPDNS;Wireless PAN DHCP Server;C:\Program Files\Intel\WiFi\bin\PanDhcpDns.exe [2011-1-4 340240]
    S3 NETw5s64;Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows 7 - 64 Bit;C:\Windows\system32\DRIVERS\NETw5s64.sys --> C:\Windows\system32\DRIVERS\NETw5s64.sys [?]
    S3 netw5v64;Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows Vista 64 Bit;C:\Windows\system32\DRIVERS\netw5v64.sys --> C:\Windows\system32\DRIVERS\netw5v64.sys [?]
    S3 RSUSBSTOR;RtsUStor.Sys Realtek USB Card Reader;C:\Windows\system32\Drivers\RtsUStor.sys --> C:\Windows\system32\Drivers\RtsUStor.sys [?]
    S3 RTL8167;Realtek 8167 NT Driver;C:\Windows\system32\DRIVERS\Rt64win7.sys --> C:\Windows\system32\DRIVERS\Rt64win7.sys [?]
    S3 SrvHsfHDA;SrvHsfHDA;C:\Windows\system32\DRIVERS\VSTAZL6.SYS --> C:\Windows\system32\DRIVERS\VSTAZL6.SYS [?]
    S3 SrvHsfV92;SrvHsfV92;C:\Windows\system32\DRIVERS\VSTDPV6.SYS --> C:\Windows\system32\DRIVERS\VSTDPV6.SYS [?]
    S3 SrvHsfWinac;SrvHsfWinac;C:\Windows\system32\DRIVERS\VSTCNXT6.SYS --> C:\Windows\system32\DRIVERS\VSTCNXT6.SYS [?]
    S3 TsUsbFlt;TsUsbFlt;C:\Windows\system32\drivers\tsusbflt.sys --> C:\Windows\system32\drivers\tsusbflt.sys [?]
    S3 USBAAPL64;Apple Mobile USB Driver;C:\Windows\system32\Drivers\usbaapl64.sys --> C:\Windows\system32\Drivers\usbaapl64.sys [?]
    S3 WatAdminSvc;Windows Activation Technologies Service;C:\Windows\system32\Wat\WatAdminSvc.exe --> C:\Windows\system32\Wat\WatAdminSvc.exe [?]
    S3 yukonw7;NDIS6.2 Miniport Driver for Marvell Yukon Ethernet Controller;C:\Windows\system32\DRIVERS\yk62x64.sys --> C:\Windows\system32\DRIVERS\yk62x64.sys [?]
    =============== Created Last 30 ================
    2011-10-02 20:53:55 41272 ----a-w- C:\Windows\SysWow64\drivers\mbamswissarmy.sys
    2011-10-01 23:52:47 69000 ----a-w- C:\ProgramData\Microsoft\Windows Defender\Definition Updates\{3C139710-2A67-4C14-AF3A-4E1C7A9686E7}\offreg.dll
    2011-10-01 23:52:42 9049936 ----a-w- C:\ProgramData\Microsoft\Windows Defender\Definition Updates\{3C139710-2A67-4C14-AF3A-4E1C7A9686E7}\mpengine.dll
    2011-09-21 23:42:13 -------- d-----w- C:\ProgramData\IObit
    2011-09-17 00:07:41 -------- d-----w- C:\Users\Alton\AppData\Local\Programs
    2011-09-17 00:03:44 8593920 ----a-w- C:\Windows\System32\drivers\NETwNs64.sys
    2011-09-16 22:59:33 -------- d-----w- C:\ProgramData\{D3B41B92-9BC2-43EB-916A-4FA9E8191837}
    2011-09-15 02:32:14 -------- d-----w- C:\Program Files (x86)\IObit Toolbar
    2011-09-15 02:32:14 -------- d-----w- C:\Program Files (x86)\Common Files\Spigot
    2011-09-15 02:32:14 -------- d-----w- C:\Program Files (x86)\Application Updater
    2011-09-15 02:31:49 -------- d-----w- C:\Users\Alton\AppData\Roaming\IObit
    2011-09-15 02:31:46 -------- d-----w- C:\Program Files (x86)\IObit
    2011-09-14 23:48:14 -------- d-----w- C:\Program Files\CCleaner
    2011-09-14 23:37:38 -------- d-----w- C:\Program Files\SUPERAntiSpyware
    2011-09-11 01:46:38 -------- d-----w- C:\Users\Alton\AppData\Local\ID Vault
    2011-09-11 01:45:33 -------- d-----w- C:\Users\Alton\AppData\Roaming\ID Vault
    2011-09-06 15:19:22 404640 ----a-w- C:\Windows\SysWow64\FlashPlayerCPLApp.cpl
    2011-09-06 15:10:14 -------- d-----w- C:\ProgramData\IsolatedStorage
    2011-09-06 15:09:12 29288 ------w- C:\Windows\System32\drivers\gidv2.sys
    2011-09-06 15:09:09 65816 ------w- C:\Windows\System32\GIDLogonCP64.dll
    2011-09-06 15:09:09 467224 ------w- C:\Windows\System32\GIDHOOK64.DLL
    2011-09-06 15:09:09 446752 ------w- C:\Windows\System32\GIDHookLogon64.dll
    2011-09-06 15:09:09 206608 ------w- C:\Windows\System32\GIDBIN1.DLL
    2011-09-06 15:09:09 109064 ------w- C:\Windows\System32\EasyHook64.dll
    2011-09-06 15:09:09 102160 ------w- C:\Windows\System32\GIDBIN3.DLL
    2011-09-06 15:08:58 -------- d-----w- C:\ProgramData\GID
    2011-09-06 15:08:57 -------- d-----w- C:\Program Files (x86)\SFT
    2011-09-06 15:06:30 -------- d-----w- C:\ProgramData\White Sky, Inc
    ==================== Find3M ====================
    2011-09-11 22:16:58 472808 ----a-w- C:\Windows\SysWow64\deployJava1.dll
    2011-09-01 00:00:50 25416 ----a-w- C:\Windows\System32\drivers\mbam.sys
    2011-08-04 21:53:53 174200 ----a-w- C:\Windows\System32\drivers\SYMEVENT64x86.SYS
    2011-07-23 05:41:23 281656 ----a-w- C:\Windows\SysWow64\PnkBstrB.xtr
    2011-07-23 05:41:23 281656 ----a-w- C:\Windows\SysWow64\PnkBstrB.exe
    2011-07-22 05:22:26 1638912 ----a-w- C:\Windows\System32\mshtml.tlb
    2011-07-22 04:54:18 1638912 ----a-w- C:\Windows\SysWow64\mshtml.tlb
    2011-07-20 09:30:42 281656 ----a-w- C:\Windows\SysWow64\PnkBstrB.ex0
    2011-07-16 05:41:50 362496 ----a-w- C:\Windows\System32\wow64win.dll
    2011-07-16 05:41:49 243200 ----a-w- C:\Windows\System32\wow64.dll
    2011-07-16 05:41:49 13312 ----a-w- C:\Windows\System32\wow64cpu.dll
    2011-07-16 05:39:10 16384 ----a-w- C:\Windows\System32\ntvdm64.dll
    2011-07-16 05:37:12 421888 ----a-w- C:\Windows\System32\KernelBase.dll
    2011-07-16 04:29:19 14336 ----a-w- C:\Windows\SysWow64\ntvdm64.dll
    2011-07-16 04:26:00 44032 ----a-w- C:\Windows\apppatch\acwow64.dll
    2011-07-16 04:25:37 25600 ----a-w- C:\Windows\SysWow64\setup16.exe
    2011-07-16 04:24:23 5120 ----a-w- C:\Windows\SysWow64\wow32.dll
    2011-07-16 04:24:22 272384 ----a-w- C:\Windows\SysWow64\KernelBase.dll
    2011-07-16 02:21:44 7680 ----a-w- C:\Windows\SysWow64\instnm.exe
    2011-07-16 02:21:41 2048 ----a-w- C:\Windows\SysWow64\user.exe
    2011-07-16 02:17:19 6144 ---ha-w- C:\Windows\SysWow64\api-ms-win-security-base-l1-1-0.dll
    2011-07-16 02:17:19 4608 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-threadpool-l1-1-0.dll
    2011-07-16 02:17:19 3584 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-xstate-l1-1-0.dll
    2011-07-16 02:17:19 3072 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-util-l1-1-0.dll
    2011-07-13 05:27:54 499712 ----a-w- C:\Windows\SysWow64\msvcp71.dll
    2011-07-13 05:27:54 348160 ----a-w- C:\Windows\SysWow64\msvcr71.dll
    2011-07-12 18:34:00 96104 ----a-w- C:\Windows\System32\dns-sd.exe
    2011-07-12 18:34:00 85864 ----a-w- C:\Windows\System32\dnssd.dll
    2011-07-12 18:34:00 61288 ----a-w- C:\Windows\System32\jdns_sd.dll
    2011-07-12 18:34:00 212840 ----a-w- C:\Windows\System32\dnssdX.dll
    2011-07-12 18:20:54 83816 ----a-w- C:\Windows\SysWow64\dns-sd.exe
    2011-07-12 18:20:54 73064 ----a-w- C:\Windows\SysWow64\dnssd.dll
    2011-07-12 18:20:54 50536 ----a-w- C:\Windows\SysWow64\jdns_sd.dll
    2011-07-12 18:20:54 178536 ----a-w- C:\Windows\SysWow64\dnssdX.dll
    2011-07-09 05:26:20 2048 ----a-w- C:\Windows\System32\tzres.dll
    2011-07-09 04:29:46 2048 ----a-w- C:\Windows\SysWow64\tzres.dll
    2011-07-09 02:46:28 288768 ----a-w- C:\Windows\System32\drivers\mrxsmb10.sys
    2011-07-09 00:45:12 386168 ----a-w- C:\Windows\System32\drivers\N360x64\0501000.01D\symnets.sys
    2011-07-06 01:37:00 94208 ----a-w- C:\Windows\SysWow64\QuickTimeVR.qtx
    2011-07-06 01:37:00 69632 ----a-w- C:\Windows\SysWow64\QuickTime.qts
    2011-07-05 17:25:38 66328 ----a-w- C:\Windows\SysWow64\SysEventMenu.dll
    2011-07-05 17:24:32 398608 ----a-w- C:\Windows\SysWow64\GIDHook.dll
    2011-07-05 17:23:48 102160 ----a-w- C:\Windows\SysWow64\GIDBIN3.dll
    2011-07-05 17:23:30 173840 ----a-w- C:\Windows\SysWow64\GIDBIN1.dll
    2011-07-05 01:41:17 75136 ----a-w- C:\Windows\SysWow64\PnkBstrA.exe
    ============= FINISH: 14:21:28.98 ===============

    DDS Attached:

    DDS (Ver_2011-08-26.01)
    Microsoft Windows 7 Home Premium
    Boot Device: \Device\HarddiskVolume1
    Install Date: 8/21/2010 10:13:05 AM
    System Uptime: 9/30/2011 3:41:18 AM (59 hours ago)
    Motherboard: Hewlett-Packard | | 144B
    Processor: Intel(R) Core(TM) i5 CPU M 450 @ 2.40GHz | CPU | 1176/1066mhz
    ==== Disk Partitions =========================
    C: is FIXED (NTFS) - 573 GiB total, 104.372 GiB free.
    D: is FIXED (NTFS) - 23 GiB total, 3.323 GiB free.
    E: is FIXED (FAT32) - 0 GiB total, 0.082 GiB free.
    F: is CDROM ()
    G: is CDROM ()
    H: is CDROM ()
    ==== Disabled Device Manager Items =============
    ==== System Restore Points ===================
    RP260: 9/23/2011 3:51:31 AM - Windows Update
    RP261: 9/27/2011 6:57:51 PM - Windows Update
    RP262: 9/27/2011 7:17:07 PM - Windows Update
    RP263: 10/1/2011 4:50:44 PM - Windows Update
    ==== Installed Programs ======================
    Adobe AIR
    Adobe Flash Player 10 ActiveX
    Adobe Reader 9.4.0 MUI
    Adobe Shockwave Player
    Advanced SystemCare 4
    Akamai NetSession Interface
    APB Reloaded
    Apple Application Support
    Apple Software Update
    Bandisoft MPEG-1 Decoder
    Battlefield 2142 Deluxe Edition
    Bejeweled 2 Deluxe
    Bing Bar
    Bing Rewards Client Installer
    Blackhawk Striker 2
    Blasterball 3
    Build-a-lot 2
    Cake Mania
    Catalyst Control Center - Branding
    Catalyst Control Center Graphics Previews Common
    Catalyst Control Center Graphics Previews Vista
    Catalyst Control Center InstallProxy
    Catalyst Control Center Localization All
    CCC Help Chinese Standard
    CCC Help Chinese Traditional
    CCC Help Czech
    CCC Help Danish
    CCC Help Dutch
    CCC Help English
    CCC Help Finnish
    CCC Help French
    CCC Help German
    CCC Help Greek
    CCC Help Hungarian
    CCC Help Italian
    CCC Help Japanese
    CCC Help Korean
    CCC Help Norwegian
    CCC Help Polish
    CCC Help Portuguese
    CCC Help Russian
    CCC Help Spanish
    CCC Help Swedish
    CCC Help Thai
    CCC Help Turkish
    Champions Online
    Chuzzle Deluxe
    CinemaNow Media Manager
    Compatibility Pack for the 2007 Office system
    Constant Guard Protection Suite
    Corel PaintShop Photo Pro X3
    Corel VideoStudio Pro X3
    CyberLink DVD Suite
    Dark Messiah
    Dead Rising 2
    Definition update for Microsoft Office 2010 (KB982726) 32-Bit Edition
    Diner Dash 2 Restaurant Rescue
    Dora's Carnival Adventure
    Dragon Raja Global
    DVD Menu Pack for HP MediaSmart Video
    Dynasty Warriors Online
    Escape Rosecliff Island
    ESU for Microsoft Windows 7
    Faerie Solitaire
    Fallout 3
    Far Cry 2
    GamersFirst LIVE!
    Google Chrome
    Grand Theft Auto IV
    Grand Theft Auto Vice City
    Hewlett-Packard ACLM.NET v1.1.1.0
    HP Advisor
    HP Customer Experience Enhancements
    HP DVB-T TV Tuner
    HP Game Console
    HP Games
    HP MediaSmart CinemaNow 2.0
    HP MediaSmart DVD
    HP MediaSmart Internet TV
    HP MediaSmart Music
    HP MediaSmart Photo
    HP MediaSmart Video
    HP MediaSmart Webcam
    HP MediaSmart/TouchSmart Netflix
    HP Photo Creations
    HP Product Detection
    HP QuickWeb Installer
    HP Setup
    HP Software Framework
    HP Support Assistant
    HP Update
    HP User Guides 0177
    Hulu Desktop
    IDT Audio
    Intel(R) Management Engine Components
    Intel(R) Rapid Storage Technology
    Intel(R) Turbo Boost Technology Driver
    IObit Malware Fighter
    IObit Toolbar v4.6
    Java Auto Updater
    Java(TM) 6 Update 26
    Jewel Quest 3
    Jewel Quest Solitaire 2
    Junk Mail filter update
    League of Legends
    LightScribe System Software
    LOTR The Return of the King tm
    Malwarebytes' Anti-Malware version
    Medieval II Total War
    Medieval II Total War : Kingdoms : Americas
    Medieval II Total War : Kingdoms : Britannia
    Medieval II Total War : Kingdoms : Crusades
    Medieval II Total War : Kingdoms : Teutonic
    Microsoft .NET Framework 1.1
    Microsoft Default Manager
    Microsoft Games for Windows - LIVE Redistributable
    Microsoft Games for Windows Marketplace
    Microsoft Office Access MUI (English) 2010
    Microsoft Office Access Setup Metadata MUI (English) 2010
    Microsoft Office Excel MUI (English) 2010
    Microsoft Office Home and Student 2010
    Microsoft Office OneNote MUI (English) 2010
    Microsoft Office Outlook MUI (English) 2010
    Microsoft Office PowerPoint MUI (English) 2010
    Microsoft Office PowerPoint Viewer 2007 (English)
    Microsoft Office Proof (English) 2010
    Microsoft Office Proof (French) 2010
    Microsoft Office Proof (Spanish) 2010
    Microsoft Office Proofing (English) 2010
    Microsoft Office Publisher MUI (English) 2010
    Microsoft Office Shared MUI (English) 2010
    Microsoft Office Shared Setup Metadata MUI (English) 2010
    Microsoft Office Single Image 2010
    Microsoft Office Suite Activation Assistant
    Microsoft Office Word MUI (English) 2010
    Microsoft Silverlight
    Microsoft SQL Server 2005 Compact Edition [ENU]
    Microsoft Visual C++ 2005 ATL Update kb973923 - x86 8.0.50727.4053
    Microsoft Visual C++ 2005 Redistributable
    Microsoft Visual C++ 2008 Redistributable - KB2467174 - x86 9.0.30729.5570
    Microsoft Visual C++ 2008 Redistributable - x86 9.0.21022
    Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17
    Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4148
    Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161
    Microsoft Visual J# .NET Redistributable Package 1.1
    Microsoft Works
    Microsoft WSE 3.0 Runtime
    Mount&Blade - Warband v1.132
    Mount&Blade Warband
    Movie Theme Pack for HP MediaSmart Video
    MSXML 4.0 SP2 (KB954430)
    MSXML 4.0 SP2 (KB973688)
    Mystery P.I. - The New York Fortune
    Nexon Game Manager
    Norton Online Backup
    Norton Security Suite
    NVIDIA PhysX
    ObjectDock Free
    Oblivion mod manager 1.1.12
    Pando Media Booster
    Plants vs. Zombies
    Poker Superstars III
    Polar Bowler
    Polar Golfer
    PunkBuster Services
    PX Profile Update
    RealNetworks - Microsoft Visual C++ 2008 Runtime
    Realtek Ethernet Controller Driver For Windows 7
    Realtek USB 2.0 Card Reader
    RealUpgrade 1.1
    Recovery Manager
    Rockstar Games Social Club
    Roxio CinemaNow 2.0
    Security Update for Microsoft .NET Framework 4 Client Profile (KB2160841)
    Security Update for Microsoft .NET Framework 4 Client Profile (KB2446708)
    Security Update for Microsoft .NET Framework 4 Client Profile (KB2478663)
    Security Update for Microsoft .NET Framework 4 Client Profile (KB2518870)
    Security Update for Microsoft .NET Framework 4 Client Profile (KB2539636)
    Security Update for Microsoft Excel 2010 (KB2553070)
    Security Update for Microsoft Office 2010 (KB2289078)
    Security Update for Microsoft Office 2010 (KB2553091)
    Security Update for Microsoft Office 2010 (KB2553096)
    Security Update for Microsoft Office 2010 (KB2584066)
    Security Update for Microsoft PowerPoint 2010 (KB2519975)
    Security Update for Microsoft Publisher 2010 (KB2409055)
    Security Update for Microsoft SharePoint Workspace 2010 (KB2566445)
    Security Update for Microsoft Word 2010 (KB2345000)
    Skype™ 5.5
    System Requirements Lab CYRI
    Team Fortress 2
    TextTwist 2
    The Battle for Middle-earth (tm) II
    The Lord of the Rings Online™ v03.02.03.8013
    The OBSE Launcher 1.7
    Third Age - Total War 2.0 (Part1of2)
    Third Age - Total War 2.0 (Part2of2)
    Tom Clancy's Splinter Cell Conviction
    TuneAid 3.51
    Ubisoft Game Launcher
    Unofficial Oblivion Patch v3.2.0
    Update for Microsoft .NET Framework 4 Client Profile (KB2468871)
    Update for Microsoft .NET Framework 4 Client Profile (KB2533523)
    Update for Microsoft Office 2010 (KB2202188)
    Update for Microsoft Office 2010 (KB2413186)
    Update for Microsoft Office 2010 (KB2494150)
    Update for Microsoft Office 2010 (KB2523113)
    Update for Microsoft Office 2010 (KB2553065)
    Update for Microsoft Office 2010 (KB2566458)
    Update for Microsoft OneNote 2010 (KB2493983)
    Update for Microsoft Outlook Social Connector (KB2583935)
    Virtual Families
    Virtual Villagers - The Secret City
    Warcraft III
    Warcraft III: All Products
    Wheel of Fortune 2
    Windows Live Communications Platform
    Windows Live Essentials
    Windows Live Installer
    Windows Live Mail
    Windows Live Messenger
    Windows Live Movie Maker
    Windows Live Photo Common
    Windows Live Photo Gallery
    Windows Live PIMT Platform
    Windows Live SOXE
    Windows Live SOXE Definitions
    Windows Live Sync
    Windows Live UX Platform
    Windows Live UX Platform Language Pack
    Windows Live Writer
    Windows Live Writer Resources
    Windows Media Encoder 9 Series
    Yahoo! BrowserPlus 2.9.8
    Yahoo! Detect
    Zuma's Revenge
    ==== Event Viewer Messages From Past Week ========
    9/30/2011 3:47:44 AM, Error: Service Control Manager [7009] - A timeout was reached (30000 milliseconds) while waiting for the Steam Client Service service to connect.
    9/30/2011 3:47:44 AM, Error: Service Control Manager [7000] - The Steam Client Service service failed to start due to the following error: The service did not respond to the start or control request in a timely fashion.
    9/30/2011 3:45:15 AM, Error: Service Control Manager [7009] - A timeout was reached (30000 milliseconds) while waiting for the HP Support Assistant Service service to connect.
    9/30/2011 3:45:15 AM, Error: Service Control Manager [7000] - The HP Support Assistant Service service failed to start due to the following error: The service did not respond to the start or control request in a timely fashion.
    9/26/2011 10:54:03 PM, Error: Service Control Manager [7009] - A timeout was reached (30000 milliseconds) while waiting for the CGPS Service service to connect.
    9/26/2011 10:54:03 PM, Error: Service Control Manager [7000] - The CGPS Service service failed to start due to the following error: The service did not respond to the start or control request in a timely fashion.
    9/26/2011 10:53:19 PM, Error: Service Control Manager [7011] - A timeout (30000 milliseconds) was reached while waiting for a transaction response from the HPWMISVC service.
    10/2/2011 2:01:54 PM, Error: NetBT [4321] - The name "ALTURO-PC :0" could not be registered on the interface with IP address The computer with the IP address did not allow the name to be claimed by this computer.
    10/1/2011 4:37:54 PM, Error: Server [2505] - The server could not bind to the transport \Device\NetBT_Tcpip_{3C4F5AAB-D4D8-4708-9349-C755C473C65A} because another computer on the network has the same name. The server could not start.
    10/1/2011 4:37:54 PM, Error: NetBT [4321] - The name "ALTURO-PC :20" could not be registered on the interface with IP address The computer with the IP address did not allow the name to be claimed by this computer.
    ==== End Of File ===========================
  6. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Here's the main reason why you're slows:

    15 BHO. browser helper objects

    4 TB toolbars

    6 auto updates

    60 Programs running

    22 HP installs

    2+ Media players running

    Advise remove this: It's a big resource user> [Advanced SystemCare 4]

    Only 1 malware entry so far: R1 GIDv2;GIDv2;C:\Windows\system32\drivers\GIDv2.sys --> C:\Windows\system32\drivers\GIDv2.sys [?

    Do you know what this installed program is? > ¶ø©g
    • Hold down Control and click on the following link to open ESET OnlineScan in a new window.
    • For alternate browsers only: (Microsoft Internet Explorer users can skip these steps)
      [o] Click on Posted Image to download the ESET Smart Installer. Save it to your desktop.
      [o] Double click on the [​IMG]on your desktop.
    • Check 'Yes I accept terms of use.'
    • Click Start button
    • Accept any security warnings from your browser.
    • Uncheck 'Remove found threats'
    • Check 'Scan archives/
    • Leave remaining settings as is.
    • Press the Start button.
    • ESET will then download updates for itself, install itself, and begin scanning your computer. Please wait for the scan to finish.
    • When the scan completes, press List of found threats
    • Push Export of text file and save the file to your desktop using a unique name, such as ESETScan. Paste this log in your next reply.
    • Push the Back button
    • Push Finish

    Please post the entire log with heading resembling this:
    NOTE: If no malware is found then no log will be produced. Let me know if this is the case.
    Please note: If you have previously run Combofix and it's still on the system, please uninstall it. Then download the current version and do the scan: Uninstall directions, if needed
    • Click START> then RUN
    • Now type Combofix /Uninstall in the runbox and click OK. Note the space between the X and the U, it needs to be there.
    Download Combofix from HERE or HERE and save to the desktop
    • Double click combofix.exe & follow the prompts.
    • ComboFix will check to see if the Microsoft Windows Recovery Console is installed. It is recommended to have this pre-installed on your machine before doing any malware removal. It will allow you to boot up into a special recovery/repair mode if needed.
      **Please note: If the Microsoft Windows Recovery Console is already installed, ComboFix will continue it's malware removal procedures.
    • Follow the prompts to allow ComboFix to download and install the Microsoft Windows Recovery Console, and when prompted, agree to the End-User License Agreement to install the Microsoft Windows Recovery Console.
    • Once installed, you should see a blue screen prompt that says:
      The Recovery Console was successfully installed.
    • .Click on Yes, to continue scanning for malware
    • .If Combofix asks you to update the program, allow
    • .Close/disable all anti virus and anti malware programs so they do not interfere with the running of ComboFix.
    • .Close any open browsers.
    • .Double click combofix.exe[​IMG] & follow the prompts to run.
    • When the scan completes , a report will be generated-it will open a text window. Please paste the C:\ComboFix.txt in next reply..
    Re-enable your Antivirus software.

    Note 1:Do not mouse-click Combofix's window while it is running. That may cause it to stall.
    Note 2: ComboFix may reset a number of Internet Explorer's settings, including making I-E the default browser.
    Note 3: Combofix prevents autorun of ALL CD, floppy and USB devices to assist with malware removal & increase security. If this is an issue or makes it difficult for you -- please tell your helper.
    Note 4: CF disconnects your machine from the internet. The connection is automatically restored before CF completes its run. If CF runs into difficulty and terminates prematurely, the connection can be manually restored by restarting your machine.
    Note 5: If you receive an error "Illegal operation attempted on a registry key that has been marked for deletion", restart computer to fix the issue.
  7. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Hi, yes I know that program, and as for the ESET scanner, It had detected norton and prompted me to uninstall Norton before continuing to install, as having 2 security systems can cause instability. What should I do?
    Edit: Never mind, It was the wrong utility, I'm installing the ESET online scanner now.
  8. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Combofix log:

    ComboFix 11-10-03.01 - Alturo 10/04/2011 1:00.1.4 - x64
    Microsoft Windows 7 Home Premium 6.1.7601.1.1252.1.1033.18.5942.3361 [GMT -7:00]
    Running from: c:\users\Alturo\Downloads\ComboFix.exe
    AV: Norton Security Suite *Disabled/Updated* {63DF5164-9100-186D-2187-8DC619EFD8BF}
    FW: Norton Security Suite *Disabled* {5BE4D041-DB6F-1935-0AD8-24F3E73C9FC4}
    SP: Norton Security Suite *Enabled/Updated* {D8BEB080-B73A-17E3-1B37-B6B462689202}
    SP: Windows Defender *Enabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
    * Created a new restore point
    ((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
    c:\program files (x86)\msvcr100.dll
    c:\program files (x86)\msvcr100.dll\from
    c:\program files (x86)\msvcr100.dll\msvcr100.dll
    ((((((((((((((((((((((((( Files Created from 2011-09-04 to 2011-10-04 )))))))))))))))))))))))))))))))
    2011-10-04 09:07 . 2011-10-04 09:07 -------- d-----w- c:\users\TeTa\AppData\Local\temp
    2011-10-04 09:07 . 2011-10-04 09:07 -------- d-----w- c:\users\Default\AppData\Local\temp
    2011-10-04 09:07 . 2011-10-04 09:07 -------- d-----w- c:\users\Alturo 2\AppData\Local\temp
    2011-10-03 20:44 . 2011-10-03 20:44 -------- d-----w- c:\program files (x86)\ESET
    2011-10-01 23:52 . 2011-10-01 23:52 69000 ----a-w- c:\programdata\Microsoft\Windows Defender\Definition Updates\{3C139710-2A67-4C14-AF3A-4E1C7A9686E7}\offreg.dll
    2011-10-01 23:52 . 2011-09-13 00:26 9049936 ----a-w- c:\programdata\Microsoft\Windows Defender\Definition Updates\{3C139710-2A67-4C14-AF3A-4E1C7A9686E7}\mpengine.dll
    2011-09-21 23:42 . 2011-09-21 23:42 -------- d-----w- c:\programdata\IObit
    2011-09-17 00:07 . 2011-09-17 00:07 -------- d-----w- c:\users\Alturo\AppData\Local\Programs
    2011-09-17 00:03 . 2011-09-17 00:03 8593920 ----a-w- c:\windows\system32\drivers\NETwNs64.sys
    2011-09-16 22:59 . 2011-09-16 22:59 -------- d-----w- c:\programdata\{D3B41B92-9BC2-43EB-916A-4FA9E8191837}
    2011-09-15 02:32 . 2011-09-15 02:32 -------- d-----w- c:\program files (x86)\IObit Toolbar
    2011-09-15 02:32 . 2011-09-15 02:32 -------- d-----w- c:\program files (x86)\Common Files\Spigot
    2011-09-15 02:32 . 2011-09-15 02:32 -------- d-----w- c:\program files (x86)\Application Updater
    2011-09-15 02:31 . 2011-09-15 02:33 -------- d-----w- c:\users\Alturo\AppData\Roaming\IObit
    2011-09-15 02:31 . 2011-09-15 02:33 -------- d-----w- c:\program files (x86)\IObit
    2011-09-14 23:48 . 2011-09-14 23:48 -------- d-----w- c:\program files\CCleaner
    2011-09-14 23:37 . 2011-09-14 23:37 -------- d-----w- c:\program files\SUPERAntiSpyware
    2011-09-11 01:46 . 2011-09-11 01:46 -------- d-----w- c:\users\Alturo\AppData\Local\ID Vault
    2011-09-11 01:45 . 2011-09-11 01:46 -------- d-----w- c:\users\Alturo\AppData\Roaming\ID Vault
    2011-09-06 15:19 . 2011-09-06 15:19 404640 ----a-w- c:\windows\SysWow64\FlashPlayerCPLApp.cpl
    2011-09-06 15:19 . 2011-09-06 15:19 -------- d-----w- c:\users\TeTa\AppData\Local\Rockstar Games
    2011-09-06 15:10 . 2011-09-06 15:10 -------- d-----w- c:\programdata\IsolatedStorage
    2011-09-06 15:10 . 2011-09-06 15:11 -------- d-----w- c:\users\TeTa\AppData\Local\ID Vault
    2011-09-06 15:09 . 2011-09-10 23:33 -------- d-----w- c:\users\TeTa\AppData\Roaming\ID Vault
    2011-09-06 15:09 . 2011-07-05 17:18 29288 ------w- c:\windows\system32\drivers\gidv2.sys
    2011-09-06 15:09 . 2011-07-05 17:25 65816 ------w- c:\windows\system32\GIDLogonCP64.dll
    2011-09-06 15:09 . 2011-07-05 17:25 467224 ------w- c:\windows\system32\GIDHOOK64.DLL
    2011-09-06 15:09 . 2011-07-05 17:24 446752 ------w- c:\windows\system32\GIDHookLogon64.dll
    2011-09-06 15:09 . 2011-07-05 17:23 102160 ------w- c:\windows\system32\GIDBIN3.DLL
    2011-09-06 15:09 . 2011-07-05 17:23 206608 ------w- c:\windows\system32\GIDBIN1.DLL
    2011-09-06 15:09 . 2009-06-12 23:32 109064 ------w- c:\windows\system32\EasyHook64.dll
    2011-09-06 15:08 . 2011-09-06 15:09 -------- d-----w- c:\programdata\GID
    2011-09-06 15:08 . 2011-09-06 15:08 -------- d-----w- c:\program files (x86)\SFT
    2011-09-06 15:07 . 2011-09-06 15:09 -------- d-----w- c:\users\TeTa\Comcast Constant Guard
    2011-09-06 15:06 . 2011-09-06 15:06 -------- d-----w- c:\programdata\White Sky, Inc
    2011-09-06 14:43 . 2011-09-06 14:43 -------- d-----w- c:\users\TeTa\AppData\Local\GamersFirst LIVE!
    2011-09-06 14:42 . 2011-09-06 15:49 -------- d-----w- c:\users\TeTa\AppData\Local\PMB Files
    2011-09-06 14:41 . 2011-09-06 14:41 -------- d-----w- c:\users\TeTa\AppData\Local\Pando_Temp
    (((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
    2011-09-11 22:16 . 2010-08-21 17:45 472808 ----a-w- c:\windows\SysWow64\deployJava1.dll
    2011-09-01 00:00 . 2011-08-29 04:18 25416 ----a-w- c:\windows\system32\drivers\mbam.sys
    2011-08-04 21:53 . 2010-10-22 01:49 174200 ----a-w- c:\windows\system32\drivers\SYMEVENT64x86.SYS
    2011-07-23 05:41 . 2010-09-26 07:16 281656 ----a-w- c:\windows\SysWow64\PnkBstrB.xtr
    2011-07-23 05:41 . 2010-09-22 08:19 281656 ----a-w- c:\windows\SysWow64\PnkBstrB.exe
    2011-07-22 05:22 . 2011-08-10 21:25 1638912 ----a-w- c:\windows\system32\mshtml.tlb
    2011-07-22 04:54 . 2011-08-10 21:25 1638912 ----a-w- c:\windows\SysWow64\mshtml.tlb
    2011-07-20 09:30 . 2010-09-22 08:19 281656 ----a-w- c:\windows\SysWow64\PnkBstrB.ex0
    2011-07-16 05:41 . 2011-08-10 21:25 362496 ----a-w- c:\windows\system32\wow64win.dll
    2011-07-16 05:41 . 2011-08-10 21:25 243200 ----a-w- c:\windows\system32\wow64.dll
    2011-07-16 05:41 . 2011-08-10 21:25 13312 ----a-w- c:\windows\system32\wow64cpu.dll
    2011-07-16 05:39 . 2011-08-10 21:25 16384 ----a-w- c:\windows\system32\ntvdm64.dll
    2011-07-16 05:37 . 2011-08-10 21:25 421888 ----a-w- c:\windows\system32\KernelBase.dll
    2011-07-16 05:21 . 2011-08-10 21:25 6144 ---ha-w- c:\windows\system32\api-ms-win-security-base-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4608 ---ha-w- c:\windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\system32\api-ms-win-core-synch-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-xstate-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-util-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-string-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4608 ---ha-w- c:\windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-misc-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-memory-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-profile-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-io-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\system32\api-ms-win-core-localization-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 5120 ---ha-w- c:\windows\system32\api-ms-win-core-file-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\system32\api-ms-win-core-heap-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-delayload-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-handle-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-fibers-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-debug-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-datetime-l1-1-0.dll
    2011-07-16 05:21 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\system32\api-ms-win-core-console-l1-1-0.dll
    2011-07-16 04:29 . 2011-08-10 21:25 14336 ----a-w- c:\windows\SysWow64\ntvdm64.dll
    2011-07-16 04:26 . 2011-08-10 21:25 44032 ----a-w- c:\windows\apppatch\acwow64.dll
    2011-07-16 04:25 . 2011-08-10 21:25 25600 ----a-w- c:\windows\SysWow64\setup16.exe
    2011-07-16 04:24 . 2011-08-10 21:25 5120 ----a-w- c:\windows\SysWow64\wow32.dll
    2011-07-16 04:24 . 2011-08-10 21:25 272384 ----a-w- c:\windows\SysWow64\KernelBase.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\SysWow64\api-ms-win-core-sysinfo-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\SysWow64\api-ms-win-core-synch-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-string-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 5120 ---ha-w- c:\windows\SysWow64\api-ms-win-core-file-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4608 ---ha-w- c:\windows\SysWow64\api-ms-win-core-processthreads-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\SysWow64\api-ms-win-core-misc-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\SysWow64\api-ms-win-core-localregistry-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-processenvironment-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-memory-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-libraryloader-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-interlocked-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-heap-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-rtlsupport-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-profile-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-io-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-handle-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-delayload-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-namedpipe-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-fibers-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-errorhandling-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-debug-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-datetime-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 4096 ---ha-w- c:\windows\SysWow64\api-ms-win-core-localization-l1-1-0.dll
    2011-07-16 04:15 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-console-l1-1-0.dll
    2011-07-16 02:21 . 2011-08-10 21:25 7680 ----a-w- c:\windows\SysWow64\instnm.exe
    2011-07-16 02:21 . 2011-08-10 21:25 2048 ----a-w- c:\windows\SysWow64\user.exe
    2011-07-16 02:17 . 2011-08-10 21:25 6144 ---ha-w- c:\windows\SysWow64\api-ms-win-security-base-l1-1-0.dll
    2011-07-16 02:17 . 2011-08-10 21:25 4608 ---ha-w- c:\windows\SysWow64\api-ms-win-core-threadpool-l1-1-0.dll
    2011-07-16 02:17 . 2011-08-10 21:25 3584 ---ha-w- c:\windows\SysWow64\api-ms-win-core-xstate-l1-1-0.dll
    2011-07-16 02:17 . 2011-08-10 21:25 3072 ---ha-w- c:\windows\SysWow64\api-ms-win-core-util-l1-1-0.dll
    2011-07-13 05:27 . 2009-07-21 20:22 499712 ----a-w- c:\windows\SysWow64\msvcp71.dll
    2011-07-13 05:27 . 2009-07-21 20:22 348160 ----a-w- c:\windows\SysWow64\msvcr71.dll
    2011-07-12 18:34 . 2011-07-12 18:34 96104 ----a-w- c:\windows\system32\dns-sd.exe
    2011-07-12 18:34 . 2011-07-12 18:34 85864 ----a-w- c:\windows\system32\dnssd.dll
    2011-07-12 18:34 . 2011-07-12 18:34 61288 ----a-w- c:\windows\system32\jdns_sd.dll
    2011-07-12 18:34 . 2011-07-12 18:34 212840 ----a-w- c:\windows\system32\dnssdX.dll
    2011-07-12 18:20 . 2011-07-12 18:20 83816 ----a-w- c:\windows\SysWow64\dns-sd.exe
    2011-07-12 18:20 . 2011-07-12 18:20 73064 ----a-w- c:\windows\SysWow64\dnssd.dll
    2011-07-12 18:20 . 2011-07-12 18:20 50536 ----a-w- c:\windows\SysWow64\jdns_sd.dll
    2011-07-12 18:20 . 2011-07-12 18:20 178536 ----a-w- c:\windows\SysWow64\dnssdX.dll
    2011-07-09 05:26 . 2011-08-24 05:39 2048 ----a-w- c:\windows\system32\tzres.dll
    2011-07-09 04:29 . 2011-08-24 05:39 2048 ----a-w- c:\windows\SysWow64\tzres.dll
    2011-07-09 02:46 . 2011-08-10 21:26 288768 ----a-w- c:\windows\system32\drivers\mrxsmb10.sys
    2011-07-09 00:45 . 2011-08-04 21:53 386168 ----a-w- c:\windows\system32\drivers\N360x64\0501000.01D\symnets.sys
    ((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
    *Note* empty entries & legit default entries are not shown
    "HPAdvisorDock"="c:\program files (x86)\Hewlett-Packard\HP Advisor\Dock\HPAdvisorDock.exe" [2010-01-28 1712184]
    "LightScribe Control Panel"="c:\program files (x86)\Common Files\LightScribe\LightScribeControlPanel.exe" [2010-11-22 2736128]
    "BitTorrent"="c:\program files (x86)\BitTorrent\BitTorrent.exe" [2011-05-08 400760]
    "DAEMON Tools Lite"="c:\program files (x86)\DAEMON Tools Lite\DTLite.exe" [2010-04-01 357696]
    "Steam"="c:\new folder\steam.exe" [2011-08-03 1242448]
    "Sidebar"="c:\program files\Windows Sidebar\sidebar.exe" [2010-11-20 1475584]
    "Skype"="c:\program files (x86)\Skype\Phone\Skype.exe" [2011-09-12 17351304]
    "SUPERAntiSpyware"="c:\program files\SUPERAntiSpyware\SUPERAntiSpyware.exe" [2011-08-12 5471104]
    "Microsoft Default Manager"="c:\program files (x86)\Microsoft\Search Enhancement Pack\Default Manager\DefMgr.exe" [2010-05-10 439568]
    "NortonOnlineBackupReminder"="c:\program files (x86)\Symantec\Norton Online Backup\Activation\NOBuActivation.exe" [2009-12-04 3331944]
    "HP Software Update"="c:\program files (x86)\Hp\HP Software Update\HPWuSchd2.exe" [2008-12-08 54576]
    "StartCCC"="c:\program files (x86)\ATI Technologies\ATI.ACE\Core-Static\CLIStart.exe" [2010-09-09 98304]
    "TkBellExe"="c:\program files (x86)\Real\RealPlayer\update\realsched.exe" [2011-07-13 273544]
    "QuickTime Task"="c:\program files (x86)\QuickTime\QTTask.exe" [2011-07-06 421888]
    "iTunesHelper"="c:\program files (x86)\iTunes\iTunesHelper.exe" [2011-08-19 421736]
    "GIDDesktop"="c:\program files (x86)\SFT\GuardedID\gidd.exe" [2011-07-05 395528]
    "SunJavaUpdateSched"="c:\program files (x86)\Common Files\Java\Java Update\jusched.exe" [2011-04-08 254696]
    "IObit Malware Fighter"="c:\program files (x86)\IObit\IObit Malware Fighter\IMF.exe" [2011-07-20 4393816]
    c:\users\Alturo\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Startup\
    Stardock ObjectDock.lnk - c:\program files (x86)\Stardock\ObjectDockFree\ObjectDock.exe [2010-10-6 3768176]
    c:\programdata\Microsoft\Windows\Start Menu\Programs\Startup\
    Constant Guard.lnk - c:\users\TeTa\Comcast Constant Guard\IDVault.exe [2011-8-31 3507784]
    GamersFirst LIVE!.lnk - c:\program files (x86)\GamersFirst\LIVE!\Live.exe [2011-8-15 2589808]
    "ConsentPromptBehaviorUser"= 3 (0x3)
    "EnableUIADesktopToggle"= 0 (0x0)
    Security Packages REG_MULTI_SZ kerberos msv1_0 schannel wdigest tspkg pku2u livessp
    R2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:\windows\Microsoft.NET\Framework\v4.0.30319\mscorsvw.exe [2010-03-18 130384]
    R2 clr_optimization_v4.0.30319_64;Microsoft .NET Framework NGEN v4.0.30319_X64;c:\windows\Microsoft.NET\Framework64\v4.0.30319\mscorsvw.exe [2010-03-18 138576]
    R2 HP Support Assistant Service;HP Support Assistant Service;c:\program files (x86)\Hewlett-Packard\HP Support Framework\hpsa_service.exe [2011-06-21 85560]
    R2 HP Wireless Assistant Service;HP Wireless Assistant Service;c:\program files\Hewlett-Packard\HP Wireless Assistant\HPWA_Service.exe [2009-12-16 102968]
    R3 BBSvc;Bing Bar Update Service;c:\program files (x86)\Microsoft\BingBar\BBSvc.EXE [2011-03-01 183560]
    R3 dc3d;MS Hardware Device Detection Driver;c:\windows\system32\DRIVERS\dc3d.sys [x]
    R3 MyWiFiDHCPDNS;Wireless PAN DHCP Server;c:\program files\Intel\WiFi\bin\PanDhcpDns.exe [2011-01-04 340240]
    R3 NETw5s64;Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows 7 - 64 Bit;c:\windows\system32\DRIVERS\NETw5s64.sys [x]
    R3 netw5v64;Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows Vista 64 Bit;c:\windows\system32\DRIVERS\netw5v64.sys [x]
    R3 osppsvc;Office Software Protection Platform;c:\program files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE [2010-01-10 4925184]
    R3 Point64;Microsoft IntelliPoint Filter Driver;c:\windows\system32\DRIVERS\point64.sys [x]
    R3 RegFilter;RegFilter;c:\program files (x86)\IObit\IObit Malware Fighter\drivers\win7_amd64\regfilter.sys [2011-03-23 33184]
    R3 RSUSBSTOR;RtsUStor.Sys Realtek USB Card Reader;c:\windows\system32\Drivers\RtsUStor.sys [x]
    R3 RTL8167;Realtek 8167 NT Driver;c:\windows\system32\DRIVERS\Rt64win7.sys [x]
    R3 SrvHsfHDA;SrvHsfHDA;c:\windows\system32\DRIVERS\VSTAZL6.SYS [x]
    R3 SrvHsfV92;SrvHsfV92;c:\windows\system32\DRIVERS\VSTDPV6.SYS [x]
    R3 SrvHsfWinac;SrvHsfWinac;c:\windows\system32\DRIVERS\VSTCNXT6.SYS [x]
    R3 TsUsbFlt;TsUsbFlt;c:\windows\system32\drivers\tsusbflt.sys [x]
    R3 UrlFilter;UrlFilter;c:\program files (x86)\IObit\IObit Malware Fighter\drivers\win7_amd64\UrlFilter.sys [2011-03-23 21328]
    R3 USBAAPL64;Apple Mobile USB Driver;c:\windows\system32\Drivers\usbaapl64.sys [x]
    R3 WatAdminSvc;Windows Activation Technologies Service;c:\windows\system32\Wat\WatAdminSvc.exe [x]
    R3 yukonw7;NDIS6.2 Miniport Driver for Marvell Yukon Ethernet Controller;c:\windows\system32\DRIVERS\yk62x64.sys [x]
    R4 FileMonitor;FileMonitor;c:\program files (x86)\IObit\IObit Malware Fighter\Drivers\win7_amd64\FileMonitor.sys [2011-07-11 20336]
    R4 HPWMISVC;HPWMISVC;c:\program files\Hewlett-Packard\HP Quick Launch\HPWMISVC.exe [2010-01-18 20480]
    S0 sptd;sptd;c:\windows\System32\Drivers\sptd.sys [x]
    S0 SymDS;Symantec Data Store;c:\windows\system32\drivers\N360x64\0501000.01D\SYMDS64.SYS [x]
    S0 SymEFA;Symantec Extended File Attributes;c:\windows\system32\drivers\N360x64\0501000.01D\SYMEFA64.SYS [x]
    S1 BHDrvx64;BHDrvx64;c:\programdata\Norton\{0C55C096-0F1D-4F28-AAA2-85EF591126E7}\N360_5.0.0.125\Definitions\BASHDefs\20110929.001\BHDrvx64.sys [2011-09-29 1152632]
    S1 DVMIO;DeviceVM IO Service;c:\windows\system32\DRIVERS\dvmio.sys [x]
    S1 GIDv2;GIDv2; [x]
    S1 IDSVia64;IDSVia64;c:\programdata\Norton\{0C55C096-0F1D-4F28-AAA2-85EF591126E7}\N360_5.0.0.125\Definitions\IPSDefs\20111001.030\IDSvia64.sys [2011-08-23 488568]
    S1 SASDIFSV;SASDIFSV;c:\program files\SUPERAntiSpyware\SASDIFSV64.SYS [2011-07-22 14928]
    S1 SASKUTIL;SASKUTIL;c:\program files\SUPERAntiSpyware\SASKUTIL64.SYS [2011-07-12 12368]
    S1 SymIRON;Symantec Iron Driver;c:\windows\system32\drivers\N360x64\0501000.01D\Ironx64.SYS [x]
    S1 SymNetS;Symantec Network Security WFP Driver;c:\windows\System32\Drivers\N360x64\0501000.01D\SYMNETS.SYS [x]
    S1 vwififlt;Virtual WiFi Filter Driver;c:\windows\system32\DRIVERS\vwififlt.sys [x]
    S2 !SASCORE;SAS Core Service;c:\program files\SUPERAntiSpyware\SASCORE64.EXE [2011-08-11 140672]
    S2 {55662437-DA8C-40c0-AADA-2C816A897A49};Power Control [2010/06/08 02:55];c:\program files (x86)\Hewlett-Packard\Media\DVD\000.fcl [2010-01-27 22:48 146928]
    S2 AESTFilters;Andrea ST Filters Service;c:\program files\IDT\WDM\AESTSr64.exe [2010-11-23 89600]
    S2 Akamai;Akamai NetSession Interface;c:\windows\System32\svchost.exe [2009-07-14 27136]
    S2 AMD External Events Utility;AMD External Events Utility;c:\windows\system32\atiesrxx.exe [x]
    S2 Application Updater;Application Updater;c:\program files (x86)\Application Updater\ApplicationUpdater.exe [2011-08-17 402328]
    S2 CinemaNow Service;CinemaNow Service;c:\program files (x86)\CinemaNow\CinemaNow Media Manager\CinemanowSvc.exe [2010-01-16 127984]
    S2 DvmMDES;DeviceVM Meta Data Export Service;c:\swsetup\QuickWeb\QW.SYS\config\DVMExportService.exe [2010-02-08 338168]
    S2 HPDrvMntSvc.exe;HP Quick Synchronization Service;c:\program files (x86)\Hewlett-Packard\Shared\HPDrvMntSvc.exe [2011-07-06 227384]
    S2 hpsrv;HP Service;c:\windows\system32\Hpservice.exe [x]
    S2 IDVaultSvc;CGPS Service;c:\users\TeTa\Comcast Constant Guard\IDVaultSvc.exe [2011-08-31 62536]
    S2 IMFservice;IMF Service;c:\program files (x86)\IObit\IObit Malware Fighter\IMFsrv.exe [2011-07-20 820568]
    S2 N360;Norton Security Suite;c:\program files (x86)\Norton Security Suite\Engine\\ccSvcHst.exe [2011-04-17 130008]
    S2 UNS;Intel(R) Management & Security Application User Notification Service;c:\program files (x86)\Intel\Intel(R) Management Engine Components\UNS\UNS.exe [2010-03-18 2320920]
    S2 vcsFPService;Validity VCS Fingerprint Service;c:\windows\system32\vcsFPService.exe [2010-01-06 2184496]
    S3 amdkmdag;amdkmdag;c:\windows\system32\DRIVERS\atikmdag.sys [x]
    S3 amdkmdap;amdkmdap;c:\windows\system32\DRIVERS\atikmpag.sys [x]
    S3 AtiHDAudioService;ATI Function Driver for HD Audio Service;c:\windows\system32\drivers\AtihdW76.sys [x]
    S3 EraserUtilRebootDrv;EraserUtilRebootDrv;c:\program files (x86)\Common Files\Symantec Shared\EENGINE\EraserUtilRebootDrv.sys [2011-08-04 136824]
    S3 HECIx64;Intel(R) Management Engine Interface;c:\windows\system32\DRIVERS\HECIx64.sys [x]
    S3 Impcd;Impcd;c:\windows\system32\DRIVERS\Impcd.sys [x]
    S3 intelkmd;intelkmd;c:\windows\system32\DRIVERS\igdpmd64.sys [x]
    S3 NETwNs64;___ Intel(R) Wireless WiFi Link 5000 Series Adapter Driver for Windows 7 - 64 Bit;c:\windows\system32\DRIVERS\NETwNs64.sys [x]
    S3 vwifimp;Microsoft Virtual WiFi Miniport Service;c:\windows\system32\DRIVERS\vwifimp.sys [x]
    [HKEY_LOCAL_MACHINE\software\wow6432node\microsoft\windows nt\currentversion\svchost]
    Akamai REG_MULTI_SZ Akamai
    [HKEY_LOCAL_MACHINE\software\wow6432node\microsoft\active setup\installed components\{10880D85-AAD9-4558-ABDC-2AB1552D831F}]
    2010-11-22 21:18 451872 ----a-w- c:\program files (x86)\Common Files\LightScribe\LSRunOnce.exe
    [HKEY_LOCAL_MACHINE\software\wow6432node\microsoft\active setup\installed components\{9191979D-821C-4EA8-B021-2DA1D859A7C5}-3Reg]
    2011-07-05 17:26 435976 ----a-w- c:\program files (x86)\SFT\GuardedID\GIDI.exe
    Contents of the 'Scheduled Tasks' folder
    2011-10-04 c:\windows\Tasks\GoogleUpdateTaskUserS-1-5-21-1298898949-3628467918-956551215-1000Core.job
    - c:\users\Alturo\AppData\Local\Google\Update\GoogleUpdate.exe [2010-08-21 17:57]
    2011-10-04 c:\windows\Tasks\GoogleUpdateTaskUserS-1-5-21-1298898949-3628467918-956551215-1000UA.job
    - c:\users\Alturo\AppData\Local\Google\Update\GoogleUpdate.exe [2010-08-21 17:57]
    2011-09-14 c:\windows\Tasks\HPCeeScheduleForALTON-PC$.job
    - c:\program files (x86)\Hewlett-Packard\HP Ceement\HPCEE.exe [2010-01-05 11:53]
    2011-09-30 c:\windows\Tasks\HPCeeScheduleForAlturo.job
    - c:\program files (x86)\Hewlett-Packard\HP Ceement\HPCEE.exe [2010-01-05 11:53]
    2011-09-10 c:\windows\Tasks\HPCeeScheduleForTeTa.job
    - c:\program files (x86)\Hewlett-Packard\HP Ceement\HPCEE.exe [2010-01-05 11:53]
    --------- x86-64 -----------
    "HP Quick Launch"="c:\program files\Hewlett-Packard\HP Quick Launch\HPMSGSVC.exe" [2010-01-18 451072]
    "HPToneControl"="c:\program files\Hewlett-Packard\HPToneControl\HPTonectl.exe" [2009-08-20 107832]
    "SunJavaUpdateSched"="c:\program files\Java\jre6\bin\jusched.exe" [2010-02-28 172032]
    "HPWirelessAssistant"="c:\program files\Hewlett-Packard\HP Wireless Assistant\DelayedAppStarter.exe" [2009-12-16 8192]
    "IntelliPoint"="c:\program files\Microsoft IntelliPoint\ipoint.exe" [2010-07-21 2327952]
    "SysTrayApp"="c:\program files\IDT\WDM\sttray64.exe" [2010-11-23 487424]
    "IgfxTray"="c:\windows\system32\igfxtray.exe" [2010-11-23 161304]
    "HotKeysCmds"="c:\windows\system32\hkcmd.exe" [2010-11-23 386584]
    "SmartMenu"="c:\program files\Hewlett-Packard\HP MediaSmart\SmartMenu.exe" [2010-01-20 611896]
    "IntelWireless"="c:\program files\Common Files\Intel\WirelessCommon\iFrmewrk.exe" [2011-01-04 1933584]
    "combofix"="c:\combofix\CF8312.3XE" [2010-11-20 345088]
    [HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Windows]
    ------- Supplementary Scan -------
    uStart Page = hxxp://
    uLocal Page = c:\windows\system32\blank.htm
    mLocal Page = c:\windows\SysWOW64\blank.htm
    uInternet Settings,ProxyOverride = *.local
    IE: E&xport to Microsoft Excel - c:\progra~2\MICROS~4\Office14\EXCEL.EXE/3000
    IE: Se&nd to OneNote - c:\progra~2\MICROS~4\Office14\ONBttnIE.dll/105
    TCP: DhcpNameServer =
    TCP: Interfaces\{FB2F70A0-B767-4F9A-8A92-4C119C9C06BA}: NameServer =
    - - - - ORPHANS REMOVED - - - -
    WebBrowser-{D4027C7F-154A-4066-A1AD-4243D8127440} - (no file)
    HKLM-Run-SynTPEnh - c:\program files (x86)\Synaptics\SynTP\SynTPEnh.exe
    "ImagePath"="\"c:\program files (x86)\Norton Security Suite\Engine\\ccSvcHst.exe\" /s \"N360\" /m \"c:\program files (x86)\Norton Security Suite\Engine\\diMaster.dll\" /prefetch:1"
    "ImagePath"="\??\c:\program files (x86)\Hewlett-Packard\Media\DVD\000.fcl"
    --------------------- LOCKED REGISTRY KEYS ---------------------
    [HKEY_USERS\S-1-5-21-1298898949-3628467918-956551215-1000\Software\SecuROM\!CAUTION! NEVER A OR CHANGE ANY KEY*]
    [HKEY_USERS\S-1-5-21-1298898949-3628467918-956551215-1000\Software\SecuROM\License information*]
    @Denied: (A 2) (Everyone)
    @Denied: (A 2) (Everyone)
    @="Shockwave Flash Object"
    @="c:\\Windows\\SysWOW64\\Macromed\\Flash\\Flash10w.ocx, 1"
    @Denied: (A 2) (Everyone)
    @="Macromedia Flash Factory Object"
    @="c:\\Windows\\SysWOW64\\Macromed\\Flash\\Flash10w.ocx, 1"
    @Denied: (A 2) (Everyone)
    [HKEY_LOCAL_MACHINE\SOFTWARE\Wow6432Node\Microsoft\Office\Common\Smart Tag\Actions\{B7EFF951-E52F-45CC-9EF7-57124F2177CC}]
    @Denied: (A) (Everyone)
    [HKEY_LOCAL_MACHINE\SOFTWARE\Wow6432Node\Microsoft\Schema Library\ActionsPane3]
    @Denied: (A) (Everyone)
    [HKEY_LOCAL_MACHINE\SOFTWARE\Wow6432Node\Microsoft\Schema Library\ActionsPane3\0]
    "Location"="c:\\Program Files (x86)\\Common Files\\Microsoft Shared\\VSTO\\ActionsPane3.xsd"
    @Denied: (Full) (Everyone)
    ------------------------ Other Running Processes ------------------------
    c:\program files (x86)\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe
    c:\program files (x86)\Bonjour\mDNSResponder.exe
    c:\program files (x86)\Common Files\LightScribe\LSSrvc.exe
    c:\program files (x86)\Intel\Intel(R) Management Engine Components\LMS\LMS.exe
    c:\program files (x86)\Microsoft\BingBar\SeaPort.EXE
    c:\program files (x86)\DigitalPersona\Bin\DPAgent.exe
    Completion time: 2011-10-04 02:19:31 - machine was rebooted
    ComboFix-quarantined-files.txt 2011-10-04 09:19
    Pre-Run: 110,076,370,944 bytes free
    Post-Run: 109,773,058,048 bytes free
    - - End Of File - - 1F08E1160490F592911F85A9816F2550

    ESET log:
    C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe probably a variant of Win32/Adware.Toolbar.Dealio application
    C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe a variant of Win32/Adware.Toolbar.Dealio application
    C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll a variant of Win32/Adware.Toolbar.Dealio application
    C:\Program Files (x86)\Ubisoft\Tom Clancy's Splinter Cell Conviction\src\system\ubiorbitapi_r2.dll a variant of Win32/Packed.VMProtect.AAA trojan
    C:\Users\Alturo\Downloads\cnet_ObjectDock_free_exe (1).exe a variant of Win32/InstallCore.C application
    C:\Users\Alturo\Downloads\cnet_ObjectDock_free_exe.exe a variant of Win32/InstallCore.C application
    C:\Users\Alturo\Downloads\Facemoods.exe probably a variant of Win32/InstallCore.A application
    C:\Users\Alturo\Downloads\Tom.Clancys.Splinter.Cell.Conviction-SKIDROW\sr-tcscc.iso a variant of Win32/Packed.VMProtect.AAA trojan
    C:\Windows\Installer\59b459.msi a variant of Win32/Adware.Toolbar.Dealio application
    Operating memory a variant of Win32/Adware.Toolbar.Dealio application
  9. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Share with me please: ¶ø©g
    Please download OTMovit by Old Timer and save to your desktop.
    • Double-click OTMoveIt3.exe to run it. (Vista users, please right click on OTMoveit3.exe and select "Run as an Administrator")
    • Copy the file paths below to the clipboard by highlighting ALL of them and pressing CTRL + C (or, after highlighting, right-click and choose Copy):
      C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe 
      C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe 
      C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll 
      C:\Program Files (x86)\Ubisoft\Tom Clancy's Splinter Cell Conviction\src\system\ubiorbitapi_r2.dll 
      C:\Users\Alturo\Downloads\cnet_ObjectDock_free_exe (1).exe 
      [start explorer]
    • Return to OTMoveIt3, right click in the "Paste Instructions for Items to be Moved" window and choose Paste.
    • Click the red Moveit! button.
    • A log of files and folders moved will be created in the c:\_OTMoveIt\MovedFiles folder in the form of Date and Time (mmddyyyy_hhmmss.log). Please open this log in Notepad and post its contents in your next reply.
    • Close OTMoveIt3
    If a file or folder cannot be moved immediately you may be asked to reboot the machine to finish the move process. If you are asked to reboot the machine choose Yes.
    Go ahead and run this please:
    Download CKScanner and save to your desktop.
    • Doubleclick CKScanner.exe and click Search For Files.
    • When the cursor hourglass disappears, click Save List To File.
    • A message box will verify that the file is saved.
    • Double-click the CKFiles.txt icon on your desktop and copy/paste the contents
      in your next reply.
    I'll check Combofix after lunch.
  10. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Hi, thanks for replying, Idk if I'm doing this right, but heres the log from the first one:

    All processes killed
    Error: Unable to interpret <C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe > in the current context!
    Error: Unable to interpret <C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe > in the current context!
    Error: Unable to interpret <C:\Program Files (x86)\IObit Toolbar\IE\4.6\iobitToolbarIE.dll > in the current context!
    Error: Unable to interpret <C:\Program Files (x86)\Ubisoft\Tom Clancy's Splinter Cell Conviction\src\system\ubiorbitapi_r2.dll > in the current context!
    Error: Unable to interpret <C:\Users\Alturo\Downloads\cnet_ObjectDock_free_exe (1).exe > in the current context!
    Error: Unable to interpret <C:\Users\Alturo\Downloads\cnet_ObjectDock_free_exe.exe > in the current context!
    Error: Unable to interpret <C:\Users\Alturo\Downloads\Facemoods.exe > in the current context!
    Error: Unable to interpret <C:\Users\Alturo\Downloads\Tom.Clancys.Splinter.Cell.Conviction-SKIDROW\sr-tcscc.iso > in the current context!
    Error: Unable to interpret <C:\Windows\Installer\59b459.msi > in the current context!
    ========== COMMANDS ==========


    User: All Users

    User: Alturo
    ->Temp folder emptied: 1067814 bytes
    ->Temporary Internet Files folder emptied: 1656340 bytes
    ->Java cache emptied: 8706303 bytes
    ->Google Chrome cache emptied: 377521456 bytes
    ->Flash cache emptied: 246763 bytes

    User: Alturo 2
    ->Temp folder emptied: 0 bytes
    ->Temporary Internet Files folder emptied: 804 bytes
    ->Flash cache emptied: 456 bytes

    User: Default
    ->Temp folder emptied: 0 bytes
    ->Temporary Internet Files folder emptied: 67 bytes

    User: Default User

    User: Public
    ->Temp folder emptied: 0 bytes

    User: TeTa
    ->Temp folder emptied: 0 bytes
    ->Temporary Internet Files folder emptied: 871 bytes
    ->Java cache emptied: 4238 bytes
    ->Flash cache emptied: 8884 bytes

    %systemdrive% .tmp files removed: 0 bytes
    %systemroot% .tmp files removed: 0 bytes
    %systemroot%\System32 .tmp files removed: 0 bytes
    %systemroot%\System32 (64bit) .tmp files removed: 0 bytes
    %systemroot%\System32\drivers .tmp files removed: 0 bytes
    Windows Temp folder emptied: 4143025 bytes
    %systemroot%\sysnative\config\systemprofile\AppData\Local\Microsoft\Windows\Temporary Internet Files folder emptied: 50397 bytes
    RecycleBin emptied: 104073 bytes

    Total Files Cleaned = 375.00 mb

    OTM by OldTimer - Version log created on 10062011_171533

    Files moved on Reboot...
    File C:\Users\Alton\AppData\Local\Temp\etilqs_1e4pcu12oztgdqb not found!
    File C:\Users\Alton\AppData\Local\Temp\etilqs_8dK4uOyfTeQLIGd not found!
    File C:\Users\Alton\AppData\Local\Temp\etilqs_gi453yDVQqH9VuY not found!
    File C:\Users\Alton\AppData\Local\Temp\etilqs_X0g4XqfJKd6aayR not found!
    C:\Users\Alton\AppData\Local\Temp\FXSAPIDebugLogFile.txt moved successfully.

    Registry entries deleted on Reboot...
  11. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    And heres CkScanner file, because it wouldn't let me put both of them as 1 reply as It exceeded the txt limit (50,000)
    CKScanner - Additional Security Risks - These are not necessarily bad
    c:\game\total war shogun 2\shogun2.v1.crack.exe
    c:\game\total war shogun 2\shogun2.v2.crack.exe
    c:\program files (x86)\\data\ui\campaign ui\pips\military-crackdown-repression.tga
    c:\program files (x86)\gamersfirst\apb reloaded\apbgame\content\release\packages\symboleditor\primitives_splatscracks.upk
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\sounds\fire_small_crackle_slick_op.ogg
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\sounds\fire_small_crackle_slick_op.ogg
    c:\program files (x86)\sega\medieval ii total war\mods\dlv_ext\data\settlements\aztec\settlements\overlays\cracked_mud_macro.texture
    c:\program files (x86)\sega\medieval ii total war\mods\dlv_ext\data\settlements\aztec\settlements\overlays\cracked_mud_micro.texture
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\characters\jester\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\cracks.sco
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\levels\map3\scene\textures\
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailtitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailtitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracktitaninterior.cfx
    c:\users\alton\downloads\total war shogun 2 update+crack-flt~dibya [].torrent
    c:\users\alton\downloads\[isohunt] grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack.torrent
    c:\users\alton\downloads\[isohunt] mount and blade 1.011 crack.torrent
    c:\users\alton\downloads\dragon age 2 ultimate dlc pack\v1.02 crack\dragonage2.exe
    c:\users\alton\downloads\dragon age 2 ultimate dlc pack\v1.02 crack\fairlight.nfo
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gratis godis här.url
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gta4-epen15.nfo
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gratis godis här.url
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta iv dvd 1.iso
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r00
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r01
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r02
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r03
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r04
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r05
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r06
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r07
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r08
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r09
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r10
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r11
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r12
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r13
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r14
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r15
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r16
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r17
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r18
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r19
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r20
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r21
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r22
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r23
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r24
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r25
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r26
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r27
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r28
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r29
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r30
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r31
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r32
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r33
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r34
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r35
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r36
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r37
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r38
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r39
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r40
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r41
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r42
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r43
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r44
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r45
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r46
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r47
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r48
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r49
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r50
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r51
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r52
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r53
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r54
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r55
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r56
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r57
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r58
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r59
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r60
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r61
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r62
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r63
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r64
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r65
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r66
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r67
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r68
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r69
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r70
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r71
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r72
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r73
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.r74
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.rar
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd1\gta4-epen15-dvd1.sfv
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gratis godis här.url
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta iv dvd 2.iso
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r00
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r01
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r02
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r03
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r04
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r05
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r06
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r07
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r08
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r09
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r10
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r11
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r12
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r13
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r14
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r15
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r16
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r17
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r18
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r19
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r20
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r21
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r22
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r23
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r24
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r25
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r26
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r27
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r28
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r29
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r30
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r31
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r32
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r33
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r34
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r35
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r36
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r37
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r38
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r39
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r40
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r41
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r42
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r43
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r44
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r45
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r46
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r47
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r48
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r49
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r50
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r51
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r52
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r53
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r54
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r55
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r56
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r57
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r58
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r59
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r60
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r61
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r62
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r63
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r64
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r65
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r66
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r67
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r68
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r69
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r70
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r71
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.r72
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.rar
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\dvd2\gta4-epen15-dvd2.sfv
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gta.4.real.proper.crack.only-fcukthescene\fts-gta4crackrealproper.nfo
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gta.4.real.proper.crack.only-fcukthescene\fts-gta4crack_realproper.rar
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gta.4.real.proper.crack.only-fcukthescene\fts-gta4crack_realproper.sfv
    c:\users\alton\downloads\grand_theft_auto_4_clonedvd_readnfo-epen15 + proper crack\gta.4.real.proper.crack.only-fcukthescene\gratis godis här.url
    c:\users\alton\downloads\mount.and.blade.warband version 1.134+crack and multiplayer\mbwmp1134.rar
    c:\users\alton\downloads\mount.and.blade.warband version 1.134+crack and multiplayer\mb_warband_setup_1134.exe
    c:\users\alton\downloads\mount.and.blade.warband version 1.134+crack and multiplayer\mount and blade instruction.nfo
    c:\users\alton\downloads\total war shogun 2 update+crack-flt~dibya\shogun2 update+crack-flt~dibya.rar
    scanner sequence 3.ZZ.11.TJAPAF
    ----- EOF -----
  12. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Oh, sry, and ¶ø©g is nothing, it's just an old game my brother had, theres no harm whats so ever from it, its just in another language.
  13. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Please run the MGA Diagnostics tool
    • You will be prompted to either “Run” or “Save” the tool. Choose to “Run” the tool and follow the on-screen prompts.
    • You will receive an Internet Explorer-Security Warning dialog box for the Windows Genuine Advantage Diagnostic Tool>
    • You must choose to Run this tool when prompted.
    • Once you are presented with the Diagnostics tool choose Continue to run the diagnostic report.
    • If the RESOLVE button is available after running the diagnostics, please click RESOLVE to allow the diagnostic tool to attempt a repair.
    • After running the MGA Diagnostic tool, click on the Windows tab and then click on Copy
    • Please return to this thread and Paste the results here for review.
    This tool will is to look on the computer itself, in the documentation you received with the computer or with your retail purchase of Windows to see if you have a Certificate of Authenticity (COA). If you have one, tell us about the COA. Tell us:

    1. What edition of Windows XP is it for, Home, Pro, or Media Center, or another version of Windows?
    2. Does it read "OEM Software" or "OEM Product" in black lettering?
    3. Or, does it have the computer manufacturer's name in black lettering?
    4. DO NOT post the Product Key.

    NOTE: The data collected with the Genuine Diagnostics Tool does NOT contain any information that can personally identify you and can be fully reviewed, by you, before being posted.
  14. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Okay, Idk if I did this right, but here you go sir.
    Diagnostic Report (1.9.0027.0):
    Windows Validation Data-->

    Validation Code: 0
    Cached Online Validation Code: 0x0
    Windows Product ID: 00359-OEM-8992687-00010
    Windows Product ID Type: 2
    Windows License Type: OEM SLP
    Windows OS version: 6.1.7601.2.00010300.1.0.003
    ID: {5A6C85D0-1B9C-4C19-BCFE-32DDC181B238}(1)
    Is Admin: Yes
    TestCab: 0x0
    LegitcheckControl ActiveX: N/A, hr = 0x80070002
    Signed By: N/A, hr = 0x80070002
    Product Name: Windows 7 Home Premium
    Architecture: 0x00000009
    Build lab: 7601.win7sp1_gdr.110622-1506
    TTS Error:
    Validation Diagnostic:
    Resolution Status: N/A

    Vista WgaER Data-->
    ThreatID(s): N/A, hr = 0x80070002
    Version: N/A, hr = 0x80070002

    Windows XP Notifications Data-->
    Cached Result: N/A, hr = 0x80070002
    File Exists: No
    Version: N/A, hr = 0x80070002
    WgaTray.exe Signed By: N/A, hr = 0x80070002
    WgaLogon.dll Signed By: N/A, hr = 0x80070002

    OGA Notifications Data-->
    Cached Result: N/A, hr = 0x80070002
    Version: N/A, hr = 0x80070002
    OGAExec.exe Signed By: N/A, hr = 0x80070002
    OGAAddin.dll Signed By: N/A, hr = 0x80070002

    OGA Data-->
    Office Status: 109 N/A
    OGA Version: N/A, 0x80070002
    Signed By: N/A, hr = 0x80070002
    Office Diagnostics: B4D0AA8B-604-645_025D1FF3-364-80041010_025D1FF3-229-80041010_025D1FF3-230-1_025D1FF3-517-80040154_025D1FF3-237-80040154_025D1FF3-238-2_025D1FF3-244-80070002_025D1FF3-258-3

    Browser Data-->
    Proxy settings: N/A
    User Agent: Mozilla/4.0 (compatible; MSIE 8.0; Win32)
    Default Browser: C:\Program Files (x86)\Internet Explorer\iexplore.exe
    Download signed ActiveX controls: Prompt
    Download unsigned ActiveX controls: Disabled
    Run ActiveX controls and plug-ins: Allowed
    Initialize and script ActiveX controls not marked as safe: Disabled
    Allow scripting of Internet Explorer Webbrowser control: Disabled
    Active scripting: Allowed
    Script ActiveX controls marked as safe for scripting: Allowed

    File Scan Data-->

    Other data-->
    Office Details: <GenuineResults><MachineData><UGUID>{5A6C85D0-1B9C-4C19-BCFE-32DDC181B238}</UGUID><Version>1.9.0027.0</Version><OS>6.1.7601.2.00010300.1.0.003</OS><Architecture>x64</Architecture><PKey>*****-*****-*****-*****-3Q6C9</PKey><PID>00359-OEM-8992687-00010</PID><PIDType>2</PIDType><SID>S-1-5-21-1298898949-3628467918-956551215</SID><SYSTEM><Manufacturer>Hewlett-Packard</Manufacturer><Model>HP Pavilion dv7 Notebook PC</Model></SYSTEM><BIOS><Manufacturer>Hewlett-Packard</Manufacturer><Version>F.23</Version><SMBIOSVersion major="2" minor="6"/><Date>20101021000000.000000+000</Date></BIOS><HWID>B2643507018400FC</HWID><UserLCID>0409</UserLCID><SystemLCID>0409</SystemLCID><TimeZone>Pacific Standard Time(GMT-08:00)</TimeZone><iJoin>0</iJoin><SBID><stat>3</stat><msppid></msppid><name></name><model></model></SBID><OEM><OEMID>HPQOEM</OEMID><OEMTableID>SLIC-MPC</OEMTableID></OEM><GANotification/></MachineData><Software><Office><Result>109</Result><Products/><Applications/></Office></Software></GenuineResults>

    Spsys.log Content: 0x80070002

    Licensing Data-->
    Software licensing service version: 6.1.7601.17514

    Name: Windows(R) 7, HomePremium edition
    Description: Windows Operating System - Windows(R) 7, OEM_SLP channel
    Activation ID: d2c04e90-c3dd-4260-b0f3-f845f5d27d64
    Application ID: 55c92734-d682-4d71-983e-d6ec3f16059f
    Extended PID: 00359-00178-926-800010-02-1033-7600.0000-1592010
    Installation ID: 019704087345278084906756718211559591096302398734550734
    Processor Certificate URL:
    Machine Certificate URL:
    Use License URL:
    Product Key Certificate URL:
    License Status: Licensed
    Remaining Windows rearm count: 2
    Trusted time: 10/10/2011 1:33:46 PM

    Windows Activation Technologies-->
    HrOffline: 0x00000000
    HrOnline: 0x00000000
    HealthStatus: 0x0000000000000000
    Event Time Stamp: 9:11:2011 15:10
    ActiveX: Registered, Version: 7.1.7600.16395
    Admin Service: Registered, Version: 7.1.7600.16395
    HealthStatus Bitmask Output:

    HWID Data-->

    OEM Activation 1.0 Data-->

    OEM Activation 2.0 Data-->
    BIOS valid for OA 2.0: yes
    Windows marker version: 0x20001
    OEMID and OEMTableID Consistent: yes
    BIOS Information:
    ACPI Table Name OEMID Value OEMTableID Value
    SSDT PmRef CpuPm
    SSDT PmRef CpuPm
  15. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Bump, I dont want this post to get closed down, no rush.
  16. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    You have numerous pirated software and most of it is cached. We do not support piracy so in order to continue support, you will need to remove all pirated programs and apps.
  17. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Does that mean all of my music? Can u list the programs that you deemed as piracy, as I have no clue which ones are which. Thanks in advance.
  18. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Piracy is when you don't pay for a program or app using a crack or keygen to get a serial number or license number free instead. Using torrent sites such as BitTorent, uTorrent, Limewire and other to get something for free instead of paying for it.

    Software piracy can be defined as "copying and using commercial software purchased by someone else". Software piracy is illegal. Each pirated piece of software takes away from company profits, reducing funds for further software development initiatives.

    It is your responsibility to know what you should pay for and not steal.
  19. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Okay removed all the music and game demos. Now what is next?
  20. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    Please run these:

    Download CKScanner and save to your desktop.
    • Doubleclick CKScanner.exe and click Search For Files.
    • When the cursor hourglass disappears, click Save List To File.
    • A message box will verify that the file is saved.
    • Double-click the CKFiles.txt icon on your desktop and copy/paste the contents
      in your next reply.
    SuperAntiSpyware Home Edition Free Version
    • Please download SuperAntiSpyware from HERE
    • Launch SuperAntiSpyware and click on 'Check for updates'.
    • Wait for the updates to be installed
    • On the main screen click on 'Scan your computer'.
    • Check: 'Perform Complete Scan then Click 'Next' to start the scan.
    • Superantispyware will now scan your computer,when it's finished it will list all/any infections found.
    • Make sure everything found has a checkmark next to it,then press 'Next'.
    • Click on 'Finish' when you've done.
    It's possible that the program will ask you to reboot in order to delete some files.

    Obtain the SuperAntiSpyware log as follows:
    • Click on 'Preferences'.
    • Click on the 'Statistics/Logs' tab.
    • Under 'Scanner Logs' double click on 'SuperAntiSpyware Scan Log'.
    It will then open in your default text editor,such as Notepad. Paste the notepad file here on your reply.
    • Hold down Control and click on the following link to open ESET OnlineScan in a new window.
    • For alternate browsers only: (Microsoft Internet Explorer users can skip these steps)
      [o] Click on Posted Image to download the ESET Smart Installer. Save it to your desktop.
      [o] Double click on the [​IMG]on your desktop.
    • Check 'Yes I accept terms of use.'
    • Click Start button
    • Accept any security warnings from your browser.
    • Uncheck 'Remove found threats'
    • Check 'Scan archives/
    • Leave remaining settings as is.
    • Press the Start button.
    • ESET will then download updates for itself, install itself, and begin scanning your computer. Please wait for the scan to finish.
    • When the scan completes, press List of found threats
    • Push Export of text file and save the file to your desktop using a unique name, such as ESETScan. Paste this log in your next reply.
    • Push the Back button
    • Push Finish
    Paste the 3 logs in next reply.
  21. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    Hi, thank you for hanging on, for some reason I've posted this 4 times now and It didn't post, so heres another shot. I've realized that the adware tencent files is a free to download software my friend downloaded a while back, and I've scanned it before downloading, it came out clean. So is that one of the main reasons for the slowdown? Here are the logs:

    CKScanner - Additional Security Risks - These are not necessarily bad
    c:\game\total war shogun 2\shogun2.v1.exe
    c:\game\total war shogun 2\shogun2.v2.exe
    c:\program files (x86)\gamersfirst\apb reloaded\apbgame\content\release\packages\symboleditor\primitives_splatscracks.upk
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\modules\1866\textures\
    c:\program files (x86)\mount&blade\sounds\fire_small_crackle_slick_op.ogg
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\modules\1866\textures\
    c:\program files (x86)\mount&blade - warband\sounds\fire_small_crackle_slick_op.ogg
    c:\program files (x86)\sega\medieval ii total war\mods\dlv_ext\data\settlements\aztec\settlements\overlays\cracked_mud_macro.texture
    c:\program files (x86)\sega\medieval ii total war\mods\dlv_ext\data\settlements\aztec\settlements\overlays\cracked_mud_micro.texture
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\characters\jester\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\cracks.sco
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\data\particles\
    c:\riot games\league of legends\rads\projects\lol_game_client\filearchives\\dump\levels\map3\scene\textures\
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaplightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackenvmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackenvmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailtitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackndetailncracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetailcracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracklightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailtitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackndetailncracktitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackpointlight.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackpointlighttitaninterior.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcrackshadow.cfx
    c:\users\alton\documents\battlefield 2142\mods\bf2142\cache\{d7b71ee2-2b81-11cf-4764-4a34a1c2c535}_79_3\rashaderstmbasedetaildirtcracktitaninterior.cfx
    scanner sequence 3.ZZ.11.ARLBOI
    ----- EOF -----

    C:\$RECYCLE.BIN\S-1-5-21-1298898949-3628467918-956551215-1000\$RXRP9NP.Conviction-SKIDROW\sr-tcscc.iso a variant of Win32/Packed.VMProtect.AAA trojan
    C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe probably a variant of Win32/Adware.Toolbar.Dealio application
    C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe a variant of Win32/Adware.Toolbar.Dealio application
    C:\Program Files (x86)\Ubisoft\Tom Clancy's Splinter Cell Conviction\src\system\ubiorbitapi_r2.dll a variant of Win32/Packed.VMProtect.AAA trojan
    C:\Users\Alton\Downloads\cnet_ObjectDock_free_exe (1).exe a variant of Win32/InstallCore.D application
    C:\Users\Alton\Downloads\cnet_ObjectDock_free_exe.exe a variant of Win32/InstallCore.D application
    C:\Users\Alton\Downloads\Facemoods.exe probably a variant of Win32/InstallCore.A application
    C:\Windows\Installer\aba2ec8.msi a variant of Win32/Adware.Toolbar.Dealio application
    Operating memory a variant of Win32/Adware.Toolbar.Dealio application
  22. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    SUPERAntiSpyware Scan Log

    Generated 10/18/2011 at 11:21 PM

    Application Version : 5.0.1134

    Core Rules Database Version : 7801
    Trace Rules Database Version: 5613

    Scan type : Complete Scan
    Total Scan Time : 03:49:44

    Operating System Information
    Windows 7 Home Premium 64-bit, Service Pack 1 (Build 6.01.7601)
    UAC On - Limited User

    Memory items scanned : 863
    Memory threats detected : 0
    Registry items scanned : 74108
    Registry threats detected : 0
    File items scanned : 206828
    File threats detected : 264

    Adware.Tracking Cookie
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@advertising[1].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@pointroll[2].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@ads.pointroll[2].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@fastclick[1].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@invitemedia[1].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@questionmarket[2].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@doubleclick[1].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@apmebf[2].txt [ Cookie:alton ]
    C:\USERS\ALTON 2\AppData\Roaming\Microsoft\Windows\Cookies\Low\alton_2@mediaplex[2].txt [ Cookie:alton ]
    C:\USERS\TETA\AppData\Roaming\Microsoft\Windows\Cookies\AXVEP6TQ.txt [ ]
    C:\USERS\TETA\AppData\Roaming\Microsoft\Windows\Cookies\AYMR6G2T.txt [ ]
    C:\USERS\TETA\AppData\Roaming\Microsoft\Windows\Cookies\903G1IIM.txt [ ]
    C:\USERS\TETA\AppData\Roaming\Microsoft\Windows\Cookies\Low\teta@adsonar[2].txt [ ]
    C:\USERS\TETA\Cookies\AXVEP6TQ.txt [ ]
    C:\USERS\TETA\Cookies\AYMR6G2T.txt [ ]

  23. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    For the Eset entries:
    Please download OTMovit by Old Timer and save to your desktop.
    • Double-click OTMoveIt3.exe to run it. (Vista users, please right click on OTMoveit3.exe and select "Run as an Administrator")
    • Copy the file paths below to the clipboard by highlighting ALL of them and pressing CTRL + C (or, after highlighting, right-click and choose Copy):
      C:\Program Files (x86)\Application Updater\ApplicationUpdater.exe 
      C:\Program Files (x86)\Common Files\Spigot\Search Settings\SearchSettings.exe
      C:\Program Files (x86)\Ubisoft\Tom Clancy's Splinter Cell Conviction\src\system\ubiorbitapi_r2.dll 
      C:\Users\Alton\Downloads\cnet_ObjectDock_free_exe (1).exe 
      [start explorer]
    • Return to OTMoveIt3, right click in the "Paste Instructions for Items to be Moved" window and choose Paste.
    • Click the red Moveit! button.
    • A log of files and folders moved will be created in the c:\_OTMoveIt\MovedFiles folder in the form of Date and Time (mmddyyyy_hhmmss.log). Please open this log in Notepad and post its contents in your next reply.
    • Close OTMoveIt3
    If a file or folder cannot be moved immediately you may be asked to reboot the machine to finish the move process. If you are asked to reboot the machine choose Yes.
    All of the following accounts>>>
    ALTON 2
    need to have Cookies reset as follows:

    Reset Cookies
    For Internet Explorer: Internet Options (through Tools or Control Panel) Privacy tab> Advanced button> CHECK 'override automatic Cookie handling'> CHECK 'accept first party Cookies'> CHECK 'Block third party Cookies'> CHECK 'allow per session Cookies'> Apply> OK.

    For Firefox: Tools> Options> Privacy> Cookies> CHECK ‘accept Cookies from Sites’> UNCHECK 'accept third party Cookies'> Set Keep until 'they expire'. This will allow you to keep Cookies for registered sites and prevent or remove others. (Note: for Firefox v3.5, after Privacy click on 'use custom settings for History.')

    I suggest using the following two add-on for Firefox. They will prevent the Tracking Cookies that come from ads and banners and other sources:
    AdBlock Plus
    Easy List

    For Chrome: Tools> Options> Under The Hood> Privacy Section> CHECK 'Restrict how third party Cookies can be used'> Close.
    (First-party and third-party cookies can be set by the website you're visiting and websites that have items embedded in the website you're visiting. But when you next visit the website, only first-party cookie information is sent to the website. Third-party cookie information isn't sent back to the websites that originally set the third-party cookies.)

    If you did not check the line to remove entries found in Superantispyware, please run it again and do so.
    Question: The first CK log showed this:
    c:\game\total war shogun 2\shogun2.v1.crack.exe
    c:\game\total war shogun 2\shogun2.v2.crack.exe

    The second log shows this:
    c:\game\total war shogun 2\shogun2.v1.exe
    c:\game\total war shogun 2\shogun2.v2.exe

    Did you uninstall the pirated programs, then go buy them?
    These 3 entries for Zentia have adware:
    Download HijackThis and save to your desktop.
    • Extract it to a directory on your hard drive called c:\HijackThis.
    • Then navigate to that directory and double-click on the hijackthis.exe file.
    • When started click on the Scan button and then the Save Log button to create a log of your information.
    • The log file and then the log will open in notepad. Be sure to click on Format> Uncheck Word Wrap when you open Notepad
    • Click on "Edit > Select All" then click on "Edit > Copy" to copy the entire contents of the log.
    • Come back here to this thread and paste (Ctrl+V) the log in your next reply.

    NOTE: Do NOT have HijackThis fix anything yet! Most of what it finds will be harmless or even required.

    This will probably finish us up.
  24. Jaabroni

    Jaabroni TS Rookie Topic Starter Posts: 18

    hi, somehow when i run otm, it gets stuck after the unregister ui or something like that, and then everything i type turns into numbers, what should I do?
  25. Bobbye

    Bobbye Helper on the Fringe Posts: 16,335   +36

    You will need to be more specific- "something like that" does not give me any information.

    Did you remove the pirated programs?
    Have you run HijackThis yet?

Similar Topics

Add New Comment

You need to be a member to leave a comment. Join thousands of tech enthusiasts and participate.
TechSpot Account You may also...